Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60890 61 / 5e-13 ZPR2 LITTLE ZIPPER 2, protein binding (.1.2) AT3G52770 49 / 5e-09 ZPR3 LITTLE ZIPPER 3, protein binding (.1) AT2G45450 44 / 2e-06 ZPR1 LITTLE ZIPPER 1, protein binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G149600 [exp] 142 / 3e-45 AT3G60890 65 / 1e-14 LITTLE ZIPPER 2, protein binding (.1.2) Potri.003G117200 [exp] 69 / 4e-16 AT3G60890 63 / 4e-14 LITTLE ZIPPER 2, protein binding (.1.2) Potri.001G114900 [exp] 60 / 7e-13 AT3G60890 57 / 1e-11 LITTLE ZIPPER 2, protein binding (.1.2) Potri.006G083201 [exp] 55 / 2e-10 AT3G52770 54 / 2e-10 LITTLE ZIPPER 3, protein binding (.1) Potri.010G237600 [exp] 43 / 9e-07 AT3G52770 49 / 7e-10 LITTLE ZIPPER 3, protein binding (.1) Potri.008G021766 [exp] 40 / 1e-05 AT3G52770 51 / 1e-10 LITTLE ZIPPER 3, protein binding (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028902 [exp] 67 / 2e-15 AT3G60890 59 / 1e-12 LITTLE ZIPPER 2, protein binding (.1.2) Lus10008913 [exp] 64 / 9e-15 AT3G60890 58 / 2e-12 LITTLE ZIPPER 2, protein binding (.1.2) Lus10007017 [exp] 61 / 3e-13 AT3G60890 48 / 3e-08 LITTLE ZIPPER 2, protein binding (.1.2) Lus10006673 [exp] 61 / 5e-13 AT3G60890 47 / 4e-08 LITTLE ZIPPER 2, protein binding (.1.2) Lus10017055 [exp] 51 / 2e-09 AT3G52770 77 / 5e-20 LITTLE ZIPPER 3, protein binding (.1) Lus10021375 [exp] 50 / 3e-09 AT3G52770 77 / 3e-20 LITTLE ZIPPER 3, protein binding (.1) Lus10022725 [exp] 45 / 2e-07 AT3G52770 73 / 5e-19 LITTLE ZIPPER 3, protein binding (.1) Lus10014188 [exp] 44 / 6e-07 AT3G52770 72 / 1e-18 LITTLE ZIPPER 3, protein binding (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G071200.1 pacid=42762915 polypeptide=Potri.014G071200.1.p locus=Potri.014G071200 ID=Potri.014G071200.1.v4.1 annot-version=v4.1 ATGTGTACTGGTACTTGTTCGAAACTGAGCCCATGCAGTCCCTTGTATATTGCTCTTAGCAATCAACAGCCATCAAAAGGACACAACCTTCGATATCATA GACTCAACCGAAGGAGAAGGTTGTCAAAAGGGAAGAGGGTGGCACTGGTACTGGTCAAGAAAGAGATGGAAATCAAGAACTTGAAACTGTACATGGAGAA TAAAAGCATCATAGAAGAGAATGAGAAGCTGAGAAAGAAAGCATTTCTTCTACACCAGGAAAATCAAGCTTTGCTTTATCAGCTCCAAAAGAAGCGCTCT AATCCTCGCCATGACCACTTGGCTCACAGCAACAACTAA
AA sequence Show only first row Show all	>Potri.014G071200.1 pacid=42762915 polypeptide=Potri.014G071200.1.p locus=Potri.014G071200 ID=Potri.014G071200.1.v4.1 annot-version=v4.1 MCTGTCSKLSPCSPLYIALSNQQPSKGHNLRYHRLNRRRRLSKGKRVALVLVKKEMEIKNLKLYMENKSIIEENEKLRKKAFLLHQENQALLYQLQKKRS NPRHDHLAHSNN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60890		ZPR2	LITTLE ZIPPER 2, protein bindi...		Potri.014G071200 [exp]	0	1
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.004G010850 [exp]	5.19	0.8642
AT1G71710			DNAse I-like superfamily prote...		Potri.005G197800 [exp]	6.70	0.8414
					Potri.008G017001 [exp]	6.92	0.8784
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Potri.016G073900 [exp]	7.07	0.8800	CTS2.13
AT5G24430			Calcium-dependent protein kina...		Potri.012G023300 [exp]	10.09	0.8671	CRK4
					Potri.001G290300 [exp]	10.95	0.8698
					Potri.016G047700 [exp]	16.58	0.8694
AT3G16030		CES101	CALLUS EXPRESSION OF RBCS 101,...		Potri.001G441400 [exp]	18.33	0.8508
AT2G38250	Trihelix		Homeodomain-like superfamily p...		Potri.003G104500 [exp]	19.44	0.7925
AT4G35160			O-methyltransferase family pro...		Potri.011G059600 [exp]	20.32	0.8666	FOMT8,OOMT2.20

Compare expression of checked genes

Potri.014G071200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.