Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01940 293 / 2e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G67530 152 / 6e-44 ATPUB49 plant U-box 49 (.1) AT2G36130 141 / 2e-43 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G44600 150 / 5e-43 AtCYP71, CYP71 cyclophilin 71, cyclophilin71 (.1) AT5G13120 109 / 5e-30 Pnsl5, ATCYP20-2 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) AT3G63400 110 / 2e-29 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) AT4G34870 100 / 6e-27 ATCYP1, ROC5 ARABIDOPSIS THALIANA CYCLOPHILIN 1, rotamase cyclophilin 5 (.1) AT2G15790 102 / 3e-26 CYP40, SQN SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) AT3G56070 98 / 3e-26 ROC2 rotamase cyclophilin 2 (.1.2) AT3G62030 99 / 9e-26 CYP20-3, ROC4 cyclophilin 20-3, rotamase CYP 4 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G149700 [exp] 300 / 4e-106 AT1G01940 293 / 3e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G148900 [exp] 155 / 4e-45 AT5G67530 806 / 0.0 plant U-box 49 (.1) Potri.009G146400 [exp] 150 / 7e-43 AT3G44600 1095 / 0.0 cyclophilin 71, cyclophilin71 (.1) Potri.016G075600 [exp] 135 / 5e-41 AT2G36130 278 / 3e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.009G106200 [exp] 116 / 9e-32 AT2G15790 561 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.004G144300 [exp] 110 / 2e-29 AT2G15790 590 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.002G185200 [exp] 106 / 9e-29 AT3G62030 293 / 2e-100 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) Potri.007G040100 [exp] 108 / 1e-28 AT2G15790 551 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.001G060200 [exp] 105 / 2e-28 AT5G13120 297 / 7e-102 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009237 [exp] 283 / 5e-99 AT1G01940 317 / 2e-112 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10007794 [exp] 167 / 3e-49 AT5G67530 868 / 0.0 plant U-box 49 (.1) Lus10004731 [exp] 163 / 1e-47 AT5G67530 916 / 0.0 plant U-box 49 (.1) Lus10006271 [exp] 149 / 1e-42 AT3G44600 1110 / 0.0 cyclophilin 71, cyclophilin71 (.1) Lus10020573 [exp] 149 / 1e-42 AT3G44600 1115 / 0.0 cyclophilin 71, cyclophilin71 (.1) Lus10021335 [exp] 126 / 1e-37 AT2G36130 286 / 1e-100 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10017010 [exp] 122 / 9e-36 AT2G36130 278 / 4e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10024831 [exp] 125 / 9e-34 AT3G63400 308 / 8e-99 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10018746 [exp] 125 / 1e-33 AT3G63400 306 / 4e-98 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10023860 [exp] 116 / 1e-31 AT2G15790 599 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [poplar] [flax] Cyclophil-like PF00160 [poplar] [flax] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Potri.014G071600.1 pacid=42764349 polypeptide=Potri.014G071600.1.p locus=Potri.014G071600 ID=Potri.014G071600.1.v4.1 annot-version=v4.1 ATGTCGGTCACTCTTCACACAAATCTTGGGGATATCAAATGCGAAATCGCATGTGATGAAGTTCCCAAAGCCTCCGAGAATTTTTTGGCTCTATGTGCTA GTGGGTATTATGATGGAACCATATTTCATCGAAATATTAAAGGGTTTATGATTCAAGGTGGAGATCCAACAGGGACAGGCAAAGGAGGGACTAGTATCTG GGGAAAGAAGTTCAATGACGAGATCAGAGAATCTCTCAAGCATAATGCGAGGGGTACACTCTCAATGGCAAATAGTGGGCCGAATACTAATGGAAGCCAG TTTTTCATAAATTATGCAAAGCAACCCCATCTCAATGGTTTGTACTCTGTGTTTGGAAAAGTAATTCATGGGTTTGAAGTTCTTGATATCATGGAAAAGA CTCAAACAGGACCAGGAGATAGACCTCTTGCAGAGATAAGGATCAATCGCGTGACAATACATGCTAACCCACTTGCTGGCTAG
AA sequence Show only first row Show all	>Potri.014G071600.1 pacid=42764349 polypeptide=Potri.014G071600.1.p locus=Potri.014G071600 ID=Potri.014G071600.1.v4.1 annot-version=v4.1 MSVTLHTNLGDIKCEIACDEVPKASENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHNARGTLSMANSGPNTNGSQ FFINYAKQPHLNGLYSVFGKVIHGFEVLDIMEKTQTGPGDRPLAEIRINRVTIHANPLAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01940			Cyclophilin-like peptidyl-prol...		Potri.014G071600 [exp]	0	1
AT1G26660			Prefoldin chaperone subunit fa...		Potri.008G091400 [exp]	2.23	0.8667
AT4G29660		EMB2752	embryo defective 2752 (.1)		Potri.012G001800 [exp]	6.24	0.8425
AT1G34160			Tetratricopeptide repeat (TPR)...		Potri.005G199800 [exp]	8.12	0.8597
AT1G07740			Tetratricopeptide repeat (TPR)...		Potri.001G020501 [exp]	10.72	0.8336
AT5G22280			unknown protein		Potri.016G073500 [exp]	15.29	0.7964
AT1G05970			RNA-binding (RRM/RBD/RNP motif...		Potri.017G030000 [exp]	18.43	0.8123
AT5G62950			RNA polymerase II, Rpb4, core ...		Potri.005G067600 [exp]	18.49	0.8242
AT1G23860		SRZ21, SRZ-21, ...	RS-containing zinc finger prot...		Potri.019G050600 [exp]	28.33	0.8200
AT3G52230			unknown protein		Potri.010G233400 [exp]	31.49	0.8145
AT4G13520		SMAP1	small acidic protein 1 (.1)		Potri.010G063100 [exp]	41.73	0.7654

Compare expression of checked genes

Potri.014G071600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.