Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45630 73 / 5e-17 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT1G12550 71 / 3e-16 HPR3 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT1G79870 60 / 2e-12 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT5G28310 48 / 3e-08 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G151200 [exp] 117 / 1e-33 AT2G45630 382 / 3e-133 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073500 [exp] 95 / 4e-25 AT2G45630 377 / 4e-131 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073400 [exp] 91 / 2e-23 AT2G45630 405 / 2e-141 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151100 [exp] 90 / 3e-23 AT2G45630 400 / 3e-140 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.003G119000 [exp] 82 / 2e-20 AT2G45630 327 / 2e-111 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G113250 [exp] 79 / 4e-19 AT1G12550 340 / 9e-117 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Potri.001G183700 [exp] 65 / 4e-14 AT1G79870 404 / 3e-142 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.003G052700 [exp] 65 / 4e-14 AT1G79870 443 / 7e-158 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036537 [exp] 83 / 2e-20 AT2G45630 384 / 8e-134 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10041393 [exp] 79 / 6e-19 AT2G45630 392 / 7e-137 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10011141 [exp] 72 / 3e-18 AT2G45630 139 / 2e-41 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10035867 [exp] 71 / 5e-16 AT1G79870 431 / 8e-153 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10025795 [exp] 69 / 2e-15 AT1G79870 438 / 6e-156 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10043043 [exp] 66 / 5e-15 AT1G48320 151 / 4e-47 Thioesterase superfamily protein (.1) Lus10041391 [exp] 64 / 7e-15 AT1G12550 131 / 3e-38 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10036538 [exp] 63 / 2e-14 AT2G45630 132 / 2e-38 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10035866 [exp] 65 / 4e-14 AT1G79870 466 / 6e-167 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10025796 [exp] 64 / 8e-14 AT1G79870 466 / 1e-166 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF02826 [poplar] [flax] 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Representative CDS sequence Show only first row Show all	>Potri.014G073600.1 pacid=42762615 polypeptide=Potri.014G073600.1.p locus=Potri.014G073600 ID=Potri.014G073600.1.v4.1 annot-version=v4.1 ATGCAAGGAGAGATCGCAGGTGATGGATTGGATGTGTTTGAGAATGAGCCTGATGTTCCAAGTGAGCTCATTGCATTAGACAATGTTGTCCTGTCGCCAC ATAGAGCAGTCCACACCGAGGAAACTTTGATGTCTTTAGTCGAACTTGTGATGGGGAATTTGGAAGCTTCCCCCCCCCCCCCAAATAAACCTTTACTTTC TGCTGTAATATTGGATGGATGA
AA sequence Show only first row Show all	>Potri.014G073600.1 pacid=42762615 polypeptide=Potri.014G073600.1.p locus=Potri.014G073600 ID=Potri.014G073600.1.v4.1 annot-version=v4.1 MQGEIAGDGLDVFENEPDVPSELIALDNVVLSPHRAVHTEETLMSLVELVMGNLEASPPPPNKPLLSAVILDG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G45630			D-isomer specific 2-hydroxyaci...		Potri.014G073600 [exp]	0	1
AT2G33620	AT-hook		AT hook motif DNA-binding fami...		Potri.005G256500 [exp]	3.46	0.8361
AT3G46630			Protein of unknown function (D...		Potri.014G023200 [exp]	3.74	0.8182
AT3G54020		AtIPCS1	Arabidopsis Inositol phosphory...		Potri.001G246300 [exp]	7.48	0.7952
					Potri.005G214850 [exp]	7.74	0.7922
AT1G79390			unknown protein		Potri.010G174700 [exp]	11.31	0.7586
AT1G51660		ATMKK4, ATMEK4	ARABIDOPSIS THALIANA MITOGEN-A...		Potri.013G110450 [exp]	22.60	0.7131
AT1G80260		EMB1427	embryo defective 1427, Spc97 /...		Potri.014G184701 [exp]	22.97	0.7872
AT3G55380		UBC14	ubiquitin-conjugating enzyme 1...		Potri.008G053900 [exp]	23.68	0.7861	Pt-UBC7.1
AT4G38960	CO		B-box type zinc finger family ...		Potri.004G162600 [exp]	26.72	0.7361
AT3G59390			unknown protein		Potri.019G051300 [exp]	27.45	0.7673

Compare expression of checked genes

Potri.014G073600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.