Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45640 163 / 1e-52 ATSAP18, HDA19 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G151500 [exp] 214 / 9e-73 AT2G45640 185 / 3e-61 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2) Potri.003G119300 [exp] 172 / 6e-56 AT2G45640 182 / 1e-59 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041388 [exp] 187 / 1e-61 AT2G45640 168 / 5e-54 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2) Lus10036540 [exp] 179 / 2e-53 AT3G61130 1015 / 0.0 galacturonosyltransferase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF06487 [poplar] [flax] SAP18 Sin3 associated polypeptide p18 (SAP18)
Representative CDS sequence Show only first row Show all	>Potri.014G074000.2 pacid=42764128 polypeptide=Potri.014G074000.2.p locus=Potri.014G074000 ID=Potri.014G074000.2.v4.1 annot-version=v4.1 AGCAGACCATTAGCTCCTCCTGCTAGAGGTTTTCCTCCTCCGCCTATTGATCGTGAGAAGACATGTACTTTATTGCTTCGGTTTTTCTACCAAGTTGGAG AACATCATAGCAAGGAGGATTTTGCTGTGAGAGGCAAGGAGCCGAAAGACGAGGTTCAGATTTATACATGGAAGGATGCTACTCTTCACGAGTTAACTGA TCTTGTCAGAGTGGTGACACCAGCAGCTAAGAGAAGAGATGCAAGACTGTCCTTTGCTTTCATATTTCCTGATACAAATGATCGTTTTGTTGTAAGAGAG GTGGGCAAGACCGATTCTCATAGAAATGGGAAGTTAGATGACAACAAAGCATTGGCTCAGCTTGGCTTCCAGATCGGAGATTACTTGGATGTGGCAATTC TATAG
AA sequence Show only first row Show all	>Potri.014G074000.2 pacid=42764128 polypeptide=Potri.014G074000.2.p locus=Potri.014G074000 ID=Potri.014G074000.2.v4.1 annot-version=v4.1 SRPLAPPARGFPPPPIDREKTCTLLLRFFYQVGEHHSKEDFAVRGKEPKDEVQIYTWKDATLHELTDLVRVVTPAAKRRDARLSFAFIFPDTNDRFVVRE VGKTDSHRNGKLDDNKALAQLGFQIGDYLDVAIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G45640		ATSAP18, HDA19	SIN3 ASSOCIATED POLYPEPTIDE 18...		Potri.014G074000 [exp]	0	1
AT3G28860		ABCB19, ATMDR11...	P-GLYCOPROTEIN 19, MULTIDRUG R...		Potri.005G241901 [exp]	7.14	0.7053
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Potri.006G064100 [exp]	9.16	0.7186
AT3G14280			unknown protein		Potri.001G163100 [exp]	9.16	0.7738
					Potri.016G067501 [exp]	9.32	0.7386
AT1G75030		ATLP-3	thaumatin-like protein 3 (.1)		Potri.002G133200 [exp]	10.00	0.8204
AT2G32990		ATGH9B8	glycosyl hydrolase 9B8 (.1)		Potri.002G225200 [exp]	10.95	0.7442
AT5G36930			Disease resistance protein (TI...		Potri.005G003900 [exp]	11.83	0.7848
AT4G03140			NAD(P)-binding Rossmann-fold s...		Potri.014G135510 [exp]	12.96	0.7867
AT4G36490		ATSFH12	SEC14-like 12 (.1)		Potri.005G119700 [exp]	13.63	0.7382
					Potri.004G047566 [exp]	13.78	0.7530

Compare expression of checked genes

Potri.014G074000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.