Potri.014G076800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20030 86 / 1e-19 RING/U-box superfamily protein (.1)
AT4G17905 84 / 2e-19 ATL4H RING/U-box superfamily protein (.1)
AT4G10150 83 / 2e-19 RING/U-box superfamily protein (.1)
AT4G10160 82 / 3e-19 RING/U-box superfamily protein (.1)
AT2G46160 81 / 7e-19 RING/U-box superfamily protein (.1)
AT4G33565 83 / 9e-19 RING/U-box superfamily protein (.1)
AT1G20823 80 / 1e-18 RING/U-box superfamily protein (.1)
AT4G28890 83 / 2e-18 RING/U-box superfamily protein (.1)
AT5G05810 82 / 2e-18 ATL43 RING/U-box superfamily protein (.1)
AT1G33480 80 / 5e-18 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G153400 360 / 1e-128 AT2G20030 83 / 8e-19 RING/U-box superfamily protein (.1)
Potri.010G235200 171 / 9e-54 AT1G20823 80 / 3e-18 RING/U-box superfamily protein (.1)
Potri.008G025300 162 / 2e-50 AT4G40070 86 / 7e-20 RING/U-box superfamily protein (.1)
Potri.019G043900 86 / 2e-20 AT3G03550 223 / 3e-71 RING/U-box superfamily protein (.1)
Potri.018G085001 87 / 5e-20 AT4G28890 290 / 2e-94 RING/U-box superfamily protein (.1)
Potri.006G239500 86 / 1e-19 AT2G20030 248 / 1e-78 RING/U-box superfamily protein (.1)
Potri.001G141200 86 / 1e-19 AT5G17600 207 / 1e-63 RING/U-box superfamily protein (.1)
Potri.010G243300 82 / 1e-19 AT2G35910 115 / 2e-32 RING/U-box superfamily protein (.1)
Potri.013G073500 84 / 3e-19 AT3G03550 262 / 2e-85 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043426 152 / 5e-46 AT4G40070 84 / 5e-19 RING/U-box superfamily protein (.1)
Lus10034157 151 / 6e-46 AT4G40070 84 / 7e-19 RING/U-box superfamily protein (.1)
Lus10012975 87 / 4e-20 AT2G20030 291 / 2e-95 RING/U-box superfamily protein (.1)
Lus10034953 87 / 5e-20 AT2G20030 278 / 2e-90 RING/U-box superfamily protein (.1)
Lus10009511 85 / 2e-19 AT2G20030 228 / 3e-71 RING/U-box superfamily protein (.1)
Lus10011702 83 / 1e-18 AT4G28890 231 / 1e-71 RING/U-box superfamily protein (.1)
Lus10013618 82 / 1e-18 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1)
Lus10041079 81 / 2e-18 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1)
Lus10023086 82 / 3e-18 AT5G53110 161 / 1e-59 RING/U-box superfamily protein (.1)
Lus10033515 80 / 3e-18 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.014G076800.2 pacid=42762432 polypeptide=Potri.014G076800.2.p locus=Potri.014G076800 ID=Potri.014G076800.2.v4.1 annot-version=v4.1
ATGTTTGATGCAGCTATGAATTTAACCACTACAGTTATTGGTTTTGGTATGAGTGTTACTTTTATTGTGTTTGTCTGTACAAGAATTATATGTGGGAGGC
TAAGAGGGGCCGAGTCCAGGCAAATGCTTGAAATTGAGTCCAGAATCGATATTGAACAGCCAGAGCATGGGATTAGTGGCCTTGAACCAGTTCTAGTTGC
TGCAATCCCCACTTTACGGTTCACACGTGAGGCGTTCAGTTCTGCAGAAGATGCACAGTGTTCGATATGTTTAGGGGAATACCAAGAAAAGGAAGTGTTG
AGGATCATGCCCAAATGTGGTCACAACTTTCACCTCTCTTGCATCGACGAATGGCTAAGAAAACACTCTACGTGCCCAGTCTGTCGGTTCCAAATACAAG
ACTCTTTCAAAGCAAAGCACATGAGACAGGCTGCAATTAGCATGGTCCAATCAATTGACAGTCCTGATACTCCAAGTGAACATTCTAGGCAATGGCTGCT
ACCCAGCTATCAGCATCAAGCGGGGAACCACAGTAATCAAAGGCATCTTGACCCTGTTCCTGGAAACTCAGAAATTACTCCTGGAGAACCCCAAACAAGC
CATTCGTGA
AA sequence
>Potri.014G076800.2 pacid=42762432 polypeptide=Potri.014G076800.2.p locus=Potri.014G076800 ID=Potri.014G076800.2.v4.1 annot-version=v4.1
MFDAAMNLTTTVIGFGMSVTFIVFVCTRIICGRLRGAESRQMLEIESRIDIEQPEHGISGLEPVLVAAIPTLRFTREAFSSAEDAQCSICLGEYQEKEVL
RIMPKCGHNFHLSCIDEWLRKHSTCPVCRFQIQDSFKAKHMRQAAISMVQSIDSPDTPSEHSRQWLLPSYQHQAGNHSNQRHLDPVPGNSEITPGEPQTS
HS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G10150 RING/U-box superfamily protein... Potri.014G076800 0 1
AT3G07970 QRT2 QUARTET 2, Pectin lyase-like s... Potri.006G052700 2.00 0.9536
AT3G05327 Cyclin family protein (.1) Potri.005G033600 2.44 0.9550
AT2G26670 GUN2, ATHO1, TE... REVERSAL OF THE DET PHENOTYPE ... Potri.018G131700 2.82 0.9320
AT5G02420 unknown protein Potri.008G029600 5.91 0.8846
AT1G56580 SVB SMALLER WITH VARIABLE BRANCHES... Potri.005G011200 6.24 0.8807
Potri.001G410477 7.41 0.9395
AT4G27745 Yippee family putative zinc-bi... Potri.015G009200 7.74 0.9108
AT2G46550 unknown protein Potri.005G071400 8.66 0.9167
AT4G10030 alpha/beta-Hydrolases superfam... Potri.019G074600 8.77 0.9346
Potri.005G084651 9.38 0.9452

Potri.014G076800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.