Potri.014G077000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01840 100 / 2e-27 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G153000 212 / 5e-71 AT1G01840 94 / 1e-24 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041376 124 / 2e-36 AT1G01840 99 / 9e-27 unknown protein
Lus10036553 110 / 5e-31 AT1G01840 101 / 9e-28 unknown protein
PFAM info
Representative CDS sequence
>Potri.014G077000.1 pacid=42764621 polypeptide=Potri.014G077000.1.p locus=Potri.014G077000 ID=Potri.014G077000.1.v4.1 annot-version=v4.1
ATGAACACCACACCACCACCAGCACCATTACCGGACCTAATATTATCATTAGAGCAAGCAGCGCTAATGGCTAAACAACTCCCATCAACAACTGACCCAA
ACCACCTTCTCCAAATCTACTCATCTCTCCACCAAGCCCACCACCACCTCTCCTCCATCCTCTCCCAAAACCAACTTCCTTCTTTCCCTCTTCCACCACC
ACCACCACCGCAAGAGAACTCTCTCTCGTCGGCCACTGGAGCTGATGAGAATGGGAACGAGCCTATGCAAGTTGGTGATGATGATGATTATGAAGAGAAT
TCCAATAAGGTGGTGTCTATTGATAAAGTGGAGGTGAGGATGAGAGATTGTTTTATCAAGAATAAGAGGCCTAAAAGGCCTCTTTCCCCGTCAACGGTGG
CCGTGGCTGAGGAGAGGAGGTTGTCCGATGATGGGTTTAGGGGAGGGATTATGGGTTTTGATCCTCATGGGACTAGGTTGAGGGCTTTGGATCTTATCTA
CCAGTTTCATGGCTGA
AA sequence
>Potri.014G077000.1 pacid=42764621 polypeptide=Potri.014G077000.1.p locus=Potri.014G077000 ID=Potri.014G077000.1.v4.1 annot-version=v4.1
MNTTPPPAPLPDLILSLEQAALMAKQLPSTTDPNHLLQIYSSLHQAHHHLSSILSQNQLPSFPLPPPPPPQENSLSSATGADENGNEPMQVGDDDDYEEN
SNKVVSIDKVEVRMRDCFIKNKRPKRPLSPSTVAVAEERRLSDDGFRGGIMGFDPHGTRLRALDLIYQFHG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G01840 unknown protein Potri.014G077000 0 1
AT4G17900 PLATZ transcription factor fam... Potri.019G051200 2.23 0.8370
AT5G39785 Protein of unknown function (D... Potri.017G082300 3.46 0.8178
AT1G12450 SNARE associated Golgi protein... Potri.003G117400 5.19 0.8028
AT5G28740 Tetratricopeptide repeat (TPR)... Potri.011G043812 6.48 0.7825
AT5G11310 Pentatricopeptide repeat (PPR)... Potri.006G247400 9.59 0.7950
AT5G24870 RING/U-box superfamily protein... Potri.006G274700 16.70 0.7723
AT3G59670 unknown protein Potri.005G144800 17.54 0.7807
AT1G08315 ARM repeat superfamily protein... Potri.003G195400 18.02 0.7400
AT1G44820 Peptidase M20/M25/M40 family p... Potri.002G085400 20.78 0.7804
AT5G61930 APO3 ACCUMULATION OF PHOTOSYSTEM ON... Potri.015G106200 22.13 0.7267

Potri.014G077000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.