Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61113 141 / 2e-45 Ubiquitin related modifier 1 (.1) AT2G45695 134 / 2e-42 Ubiquitin related modifier 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041378 [exp] 145 / 7e-47 AT3G61113 179 / 2e-60 Ubiquitin related modifier 1 (.1) Lus10036551 [exp] 144 / 3e-46 AT3G61113 177 / 1e-59 Ubiquitin related modifier 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF09138 [poplar] [flax] Urm1 Urm1 (Ubiquitin related modifier)
Representative CDS sequence Show only first row Show all	>Potri.014G078200.1 pacid=42762946 polypeptide=Potri.014G078200.1.p locus=Potri.014G078200 ID=Potri.014G078200.1.v4.1 annot-version=v4.1 ATGCAACTCACTCTTGAATTCGGTGGTGGGCTTGAGCTTCTCTGTGATTCAGTGAAGATTCATAATGTGGATGTTAGCCCTAATAATGAAGTAGACAAGT TCACTATGAAAGATTTACTTGTGTGGGTTCGTGCTAATCTGATCAAGGAGAGGCCAGAAATGTTCATGAAAGACGATTCTGTGAGACCTGGTGTTTTAGT TCTTGTCAATGATTGTGATTGGGAACTTAGCGGTCAGCTCGATACGCCTTTGGAAGAGAAGGATGTGGTGGTTTTTATCTCTACCTTGCACGGTGGTTAG
AA sequence Show only first row Show all	>Potri.014G078200.1 pacid=42762946 polypeptide=Potri.014G078200.1.p locus=Potri.014G078200 ID=Potri.014G078200.1.v4.1 annot-version=v4.1 MQLTLEFGGGLELLCDSVKIHNVDVSPNNEVDKFTMKDLLVWVRANLIKERPEMFMKDDSVRPGVLVLVNDCDWELSGQLDTPLEEKDVVVFISTLHGG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61113			Ubiquitin related modifier 1 (...		Potri.014G078200 [exp]	0	1
AT1G03730			unknown protein		Potri.013G130300 [exp]	1.00	0.8092
AT1G23260		MMZ1 ,UEV1A	UBIQUITIN E2 VARIANT 1A, MMS Z...		Potri.010G107700 [exp]	5.09	0.7286
AT5G02570			Histone superfamily protein (....		Potri.017G123700 [exp]	6.32	0.7860	HTB903
AT1G31340		NEDD8, ATRUB1, ...	ARABIDOPSIS THALIANA RELATED T...		Potri.002G062500 [exp]	6.63	0.7752
AT1G68220			Protein of unknown function (D...		Potri.008G124100 [exp]	9.32	0.7767
AT5G10980			Histone superfamily protein (....		Potri.002G026800 [exp]	10.58	0.7461	HTR908
AT1G51730			Ubiquitin-conjugating enzyme f...		Potri.001G199500 [exp]	13.78	0.7182
AT5G66290			unknown protein		Potri.005G116300 [exp]	15.49	0.7060
AT2G04900			unknown protein		Potri.014G164500 [exp]	16.15	0.7643
AT5G10980			Histone superfamily protein (....		Potri.007G096700 [exp]	16.24	0.7345	HTR911

Compare expression of checked genes

Potri.014G078200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.