Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45760 105 / 2e-28 BAL, BAP2 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) AT3G61190 95 / 9e-25 BAP1 BON association protein 1 (.1.2) AT1G04540 44 / 3e-05 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT2G13350 42 / 9e-05 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT3G04360 42 / 0.0001 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT4G15755 40 / 0.0004 Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G155300 [exp] 155 / 2e-48 AT2G45760 120 / 4e-34 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Potri.014G078700 [exp] 155 / 3e-48 AT2G45760 116 / 1e-32 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Potri.010G024200 [exp] 54 / 1e-08 AT3G16510 135 / 5e-37 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.001G108300 [exp] 52 / 2e-08 AT2G45760 59 / 7e-11 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Potri.001G070400 [exp] 46 / 6e-06 AT3G16510 82 / 4e-17 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.013G107175 [exp] 45 / 1e-05 AT3G16510 77 / 1e-15 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.003G160400 [exp] 44 / 2e-05 AT3G16510 72 / 8e-14 Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036571 [exp] 150 / 6e-46 AT2G45760 105 / 2e-28 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Lus10040923 [exp] 141 / 1e-42 AT2G45760 110 / 4e-30 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Lus10009818 [exp] 127 / 1e-36 AT2G45760 120 / 6e-34 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Lus10040924 [exp] 124 / 2e-35 AT2G45760 119 / 3e-33 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Lus10027502 [exp] 53 / 2e-08 AT5G23950 164 / 8e-50 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10024505 [exp] 46 / 3e-06 AT2G45760 58 / 3e-10 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1) Lus10008004 [exp] 46 / 3e-06 AT2G45760 56 / 1e-09 BON ASSOCIATION PROTEIN 1-LIKE, BON association protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0154 [poplar] [flax] C2 PF00168 [poplar] [flax] C2 C2 domain
Representative CDS sequence Show only first row Show all	>Potri.014G078600.1 pacid=42763635 polypeptide=Potri.014G078600.1.p locus=Potri.014G078600 ID=Potri.014G078600.1.v4.1 annot-version=v4.1 ATGTCGCCTTTCAATCTGACGGAGACCTCGTCCTTCCACACCATAGAAATCACTGTGCTATCATGTGAAGACTTGCGTATTAATGGCAGATCGGTGAAGA AGAACACTTGTGTTGTTGTTCGGACGGACCCTCTAAACTTTCGCGAAACAACAACCGACACCGAAGGAGGAAGCTATCCTTCATGGGACCAAAAACTTAC TCTAGATATGTCAATACGAGAAACCTGTATAACCCTAGAAGTGCATTGCAGGACTCTTTCTGTGGATAGAATTATTGGTTCAGCAAGAATGCCTGTGAGT GATTTCATGGGAGGGTATTTCCCAGAGGGTTATTTGAGCTTTTTGAGTTATAGATTGAAGGATACAAAAGGATTTGAGAACGGGATTATTAATGTTTCGG TGAGACTAAGAGCGCCGGAATATTTGGCCAGGAAGAAGAAGGTCATCTTGCCCGAAGACAAATGTTCAACATCACGACCCGCGTTGGCATTGCCGGCAAT GGATGGAAAGAATTATGACGGGGTTGACTGGTATTCCTGCTCGAAATACTAA
AA sequence Show only first row Show all	>Potri.014G078600.1 pacid=42763635 polypeptide=Potri.014G078600.1.p locus=Potri.014G078600 ID=Potri.014G078600.1.v4.1 annot-version=v4.1 MSPFNLTETSSFHTIEITVLSCEDLRINGRSVKKNTCVVVRTDPLNFRETTTDTEGGSYPSWDQKLTLDMSIRETCITLEVHCRTLSVDRIIGSARMPVS DFMGGYFPEGYLSFLSYRLKDTKGFENGIINVSVRLRAPEYLARKKKVILPEDKCSTSRPALALPAMDGKNYDGVDWYSCSKY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G45760		BAL, BAP2	BON ASSOCIATION PROTEIN 1-LIKE...		Potri.014G078600 [exp]	0	1
AT1G58190		AtRLP9	receptor like protein 9 (.1.2)		Potri.001G063500 [exp]	5.74	0.9060
AT5G57510			unknown protein		Potri.018G094100 [exp]	16.55	0.9384
AT5G13170		SAG29, SWEET15,...	senescence-associated gene 29 ...		Potri.003G166800 [exp]	16.67	0.8543
					Potri.011G081701 [exp]	19.05	0.9213
					Potri.019G017304 [exp]	20.39	0.9211
AT4G37760		SQE3	squalene epoxidase 3 (.1)		Potri.012G121320 [exp]	22.09	0.9383
AT4G37290			unknown protein		Potri.005G142900 [exp]	24.97	0.9196
AT5G44440			FAD-binding Berberine family p...		Potri.011G158100 [exp]	26.90	0.9341
AT2G31945			unknown protein		Potri.001G230900 [exp]	28.98	0.8535
AT3G61510		AT-ACS1, ACS1	ARABIDOPSIS THALIANA 1-AMINOCY...		Potri.002G163700 [exp]	29.03	0.9359	Pt-ACS1.3

Compare expression of checked genes

Potri.014G078600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.