Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00620 101 / 2e-27 EMB3127 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1) AT2G38660 77 / 9e-19 Amino acid dehydrogenase family protein (.1.2.3.4) AT3G12290 68 / 3e-15 Amino acid dehydrogenase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G157100 [exp] 128 / 2e-37 AT4G00620 545 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1) Potri.006G114100 [exp] 71 / 4e-16 AT2G38660 456 / 2e-161 Amino acid dehydrogenase family protein (.1.2.3.4) Potri.011G098600 [exp] 69 / 2e-15 AT3G12290 473 / 3e-170 Amino acid dehydrogenase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011368 [exp] 103 / 3e-28 AT4G00620 523 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1) Lus10006425 [exp] 102 / 6e-28 AT4G00620 529 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1) Lus10018843 [exp] 101 / 7e-28 AT4G00620 489 / 1e-175 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1) Lus10017822 [exp] 101 / 1e-27 AT4G00620 488 / 4e-175 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1) Lus10022670 [exp] 98 / 1e-25 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1) Lus10034187 [exp] 73 / 7e-17 AT2G38660 473 / 5e-168 Amino acid dehydrogenase family protein (.1.2.3.4) Lus10043398 [exp] 73 / 8e-17 AT2G38660 469 / 2e-166 Amino acid dehydrogenase family protein (.1.2.3.4) Lus10012502 [exp] 0 / 1 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0603 [poplar] [flax] AA_dh_N PF00763 [poplar] [flax] THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
Representative CDS sequence Show only first row Show all	>Potri.014G080701.1 pacid=42762288 polypeptide=Potri.014G080701.1.p locus=Potri.014G080701 ID=Potri.014G080701.1.v4.1 annot-version=v4.1 ATGGTGGCAAAGCAAATAAGAGATGGGATAACTGCTCAAGTGTTGAAGATGAAGGAAGCAATTAGTGTTGTTCCTGGTTTAGCAGGGATTCTTGTTGGTG ACTGGAAGGATTCTTCTACTTATGTTCGCAACAAGAATAAAGCTTGTGCATTTGTGGGAATAAACTCTTTTGAAGTACGTCTGCCAGAAGATTCTACCGA ACAAGAATTGATTAAGTTTATTTAG
AA sequence Show only first row Show all	>Potri.014G080701.1 pacid=42762288 polypeptide=Potri.014G080701.1.p locus=Potri.014G080701 ID=Potri.014G080701.1.v4.1 annot-version=v4.1 MVAKQIRDGITAQVLKMKEAISVVPGLAGILVGDWKDSSTYVRNKNKACAFVGINSFEVRLPEDSTEQELIKFI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Potri.014G080701 [exp]	0	1
AT1G60680		AGD2	NAD(P)-linked oxidoreductase s...		Potri.005G052400 [exp]	1.41	0.8678
AT3G54540		ABCF4, ATGCN4	ATP-binding cassette F4, gener...		Potri.016G015550 [exp]	4.24	0.7964
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Potri.010G073300 [exp]	5.19	0.8275
AT1G33050			unknown protein		Potri.011G149601 [exp]	8.00	0.7922
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Potri.009G108500 [exp]	11.40	0.7751
AT2G39100			RING/U-box superfamily protein...		Potri.008G215200 [exp]	12.64	0.7982
					Potri.006G088616 [exp]	14.38	0.7917
AT1G09030	CCAAT	NF-YB4	"nuclear factor Y, subunit B4"...		Potri.005G027400 [exp]	21.33	0.7925
AT4G02340			alpha/beta-Hydrolases superfam...		Potri.013G134900 [exp]	21.90	0.7588
AT2G29040			Exostosin family protein (.1)		Potri.009G032500 [exp]	24.53	0.7711

Compare expression of checked genes

Potri.014G080701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.