Potri.014G081300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61260 199 / 3e-65 Remorin family protein (.1)
AT2G45820 185 / 6e-60 Remorin family protein (.1)
AT5G23750 184 / 3e-59 Remorin family protein (.1.2)
AT3G48940 174 / 9e-56 Remorin family protein (.1)
AT1G63295 92 / 1e-23 Remorin family protein (.1)
AT4G00670 85 / 2e-21 Remorin family protein (.1)
AT3G57540 66 / 6e-13 Remorin family protein (.1)
AT2G41870 63 / 7e-12 Remorin family protein (.1)
AT1G30320 63 / 1e-11 Remorin family protein (.1)
AT1G67590 57 / 6e-10 Remorin family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G157700 259 / 4e-89 AT3G61260 167 / 2e-52 Remorin family protein (.1)
Potri.015G143600 179 / 2e-57 AT5G23750 111 / 1e-30 Remorin family protein (.1.2)
Potri.003G124400 163 / 2e-51 AT5G23750 129 / 6e-38 Remorin family protein (.1.2)
Potri.012G140800 159 / 1e-49 AT5G23750 98 / 2e-25 Remorin family protein (.1.2)
Potri.001G107000 135 / 3e-40 AT5G23750 55 / 2e-09 Remorin family protein (.1.2)
Potri.006G053200 70 / 2e-14 AT3G57540 196 / 2e-61 Remorin family protein (.1)
Potri.012G140900 67 / 3e-14 AT3G48940 78 / 6e-19 Remorin family protein (.1)
Potri.016G054400 66 / 4e-13 AT2G41870 206 / 7e-66 Remorin family protein (.1)
Potri.008G178300 59 / 2e-10 AT1G67590 306 / 1e-102 Remorin family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018840 217 / 4e-72 AT3G61260 206 / 1e-67 Remorin family protein (.1)
Lus10017811 206 / 1e-67 AT3G61260 199 / 5e-65 Remorin family protein (.1)
Lus10039215 189 / 5e-61 AT3G61260 196 / 7e-64 Remorin family protein (.1)
Lus10014785 186 / 4e-60 AT3G61260 177 / 1e-56 Remorin family protein (.1)
Lus10027460 186 / 7e-60 AT3G61260 192 / 2e-62 Remorin family protein (.1)
Lus10030379 174 / 2e-55 AT3G61260 178 / 4e-57 Remorin family protein (.1)
Lus10001477 141 / 5e-42 AT5G23750 162 / 3e-50 Remorin family protein (.1.2)
Lus10008014 137 / 9e-42 AT5G23750 158 / 5e-50 Remorin family protein (.1.2)
Lus10008477 137 / 2e-40 AT5G23750 154 / 5e-47 Remorin family protein (.1.2)
Lus10024514 99 / 3e-26 AT5G23750 113 / 5e-32 Remorin family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03763 Remorin_C Remorin, C-terminal region
PF03766 Remorin_N Remorin, N-terminal region
Representative CDS sequence
>Potri.014G081300.1 pacid=42764689 polypeptide=Potri.014G081300.1.p locus=Potri.014G081300 ID=Potri.014G081300.1.v4.1 annot-version=v4.1
ATGGCTGAGCAAGAAGTGAAGAAGGTAGAAACTGAGACGCCGGTGACTCCAGCTCCGGTGGAAACTAAAAGCGATGTGGCGGATGAGAAAGCTATAGTTC
CACCACCTCCAGCAGCTGAAGAGAAAGAGAAGGTAGCCGATGAATTAAAAGCTCTTGCTGTTGTTGAAAAGACAGAACCTGCTCCGAAAAAGATTTCAGG
TGGATCAATTGACAGAGATATAGCTCTTGCTGACCTTGAAAAAGAAAAGAGACTGTCCTTTATCAAGGCATGGGAAGACAGCGAGAAAACTAAAGCGGAA
AACAAGTCTCAGAAAAAGCTCTCTGCTGTTGTTGCATGGGAGAACAGCAAAAAGGCAGCTCTGGAAGCCACACTAAGAAAGATGGAGGAAAAATTGGAGA
AACAAAAGGCAGAATACGCAGAGAAAATGAAAAACAAGGTTGCTTTGATTCATAAAGATGCTGAAGAACAGAGGGCCATGGTTGAAGCCAAACGTGGCGA
AGAATTCTTAAAAGCAGAGGAGATGGCAGCGAAATATCGTGCTACTGGGCAAACCCCGAAGAAGCTTCTTGGTTGCTTCTGA
AA sequence
>Potri.014G081300.1 pacid=42764689 polypeptide=Potri.014G081300.1.p locus=Potri.014G081300 ID=Potri.014G081300.1.v4.1 annot-version=v4.1
MAEQEVKKVETETPVTPAPVETKSDVADEKAIVPPPPAAEEKEKVADELKALAVVEKTEPAPKKISGGSIDRDIALADLEKEKRLSFIKAWEDSEKTKAE
NKSQKKLSAVVAWENSKKAALEATLRKMEEKLEKQKAEYAEKMKNKVALIHKDAEEQRAMVEAKRGEEFLKAEEMAAKYRATGQTPKKLLGCF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G61260 Remorin family protein (.1) Potri.014G081300 0 1
AT3G45640 ATMAPK3, ATMPK3 mitogen-activated protein kina... Potri.001G271700 1.41 0.9033 MPK3.1
AT1G29220 transcriptional regulator fami... Potri.004G058700 1.73 0.9084
AT1G78230 Outer arm dynein light chain 1... Potri.002G097800 3.87 0.9026
AT1G79270 ECT8 evolutionarily conserved C-ter... Potri.010G175500 7.48 0.8693
AT5G55340 MBOAT (membrane bound O-acyl t... Potri.008G145700 10.95 0.8624
AT3G45260 C2H2ZnF C2H2-like zinc finger protein ... Potri.006G227600 14.24 0.8701
AT4G36710 GRAS AtHAM4 Arabidopsis thaliana HAIRY MER... Potri.007G029200 15.49 0.8759
AT4G17870 RCAR11, PYR1 regulatory component of ABA re... Potri.001G142500 17.32 0.8496
AT2G46140 Late embryogenesis abundant pr... Potri.002G165000 17.94 0.8611 PM22.2
AT1G10790 unknown protein Potri.001G210600 18.70 0.8144

Potri.014G081300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.