Potri.014G082800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G00530 102 / 7e-31 unknown protein
AT1G01725 76 / 2e-20 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037854 95 / 6e-28 AT4G00530 91 / 2e-26 unknown protein
PFAM info
Representative CDS sequence
>Potri.014G082800.1 pacid=42763863 polypeptide=Potri.014G082800.1.p locus=Potri.014G082800 ID=Potri.014G082800.1.v4.1 annot-version=v4.1
ATGATATACAAGGCGATGAATCCTCGAACAGACAAGATAGTGAGGAGGACAACAATGGTAGCCACTGCTGTTGCTTCTTATTTCCTCTTAACTGCTGACT
ATGGTCCTCAACCCAATGCTGTTGAACCCATCAAAAGGGCCATATTATCAGCACAAAGTTCTGTGAAAGAGTTCATCTTTGGATCAGGGAAAGAGTCCTG
A
AA sequence
>Potri.014G082800.1 pacid=42763863 polypeptide=Potri.014G082800.1.p locus=Potri.014G082800 ID=Potri.014G082800.1.v4.1 annot-version=v4.1
MIYKAMNPRTDKIVRRTTMVATAVASYFLLTADYGPQPNAVEPIKRAILSAQSSVKEFIFGSGKES

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G00530 unknown protein Potri.014G082800 0 1
AT1G62390 CLMP1, Phox2 Phox2, CLUMPED CHLOROPLASTS 1,... Potri.004G002900 6.00 0.8745
AT5G11340 Acyl-CoA N-acyltransferases (N... Potri.018G032400 7.34 0.8422
AT3G44190 FAD/NAD(P)-binding oxidoreduct... Potri.001G217800 7.41 0.8632
AT4G26780 MGE2, AR192 mitochondrial GrpE 2, Co-chape... Potri.015G065800 8.00 0.8665
AT4G10270 Wound-responsive family protei... Potri.019G116600 9.48 0.8409
AT1G23860 SRZ21, SRZ-21, ... RS-containing zinc finger prot... Potri.019G050600 9.48 0.8660
AT3G47520 pNAD-MDH, MDH plastidic NAD-dependent malate... Potri.004G112800 10.48 0.8862 Pt-NEMDH.2
AT4G22140 EBS EARLY BOLTING IN SHORT DAYS, P... Potri.002G226000 12.24 0.8638
AT5G62290 nucleotide-sensitive chloride ... Potri.012G128500 13.41 0.8709
AT2G37975 Yos1-like protein (.1) Potri.016G109500 13.41 0.8581

Potri.014G082800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.