Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-UBC4.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41340 283 / 1e-98 ATUBC4, UBC4 ubiquitin conjugating enzyme 4 (.1) AT1G63800 283 / 1e-98 UBC5 ubiquitin-conjugating enzyme 5 (.1) AT2G46030 268 / 5e-93 UBC6 ubiquitin-conjugating enzyme 6 (.1) AT3G08690 99 / 2e-26 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G53300 98 / 3e-26 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT2G16740 98 / 4e-26 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G41700 97 / 5e-26 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT1G64230 97 / 6e-26 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT4G27960 97 / 8e-26 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT3G08700 96 / 1e-25 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G161000 [exp] 327 / 5e-116 AT1G63800 288 / 1e-100 ubiquitin-conjugating enzyme 5 (.1) Potri.001G101900 [exp] 302 / 2e-106 AT5G41340 292 / 3e-102 ubiquitin conjugating enzyme 4 (.1) Potri.003G129700 [exp] 293 / 1e-102 AT5G41340 284 / 5e-99 ubiquitin conjugating enzyme 4 (.1) Potri.015G073400 [exp] 261 / 6e-90 AT5G41340 268 / 1e-92 ubiquitin conjugating enzyme 4 (.1) Potri.011G168200 [exp] 97 / 6e-26 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.012G104100 [exp] 98 / 7e-26 AT5G50870 334 / 1e-118 ubiquitin-conjugating enzyme 27 (.1.2) Potri.004G175000 [exp] 97 / 9e-26 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.003G136200 [exp] 96 / 1e-25 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.016G138900 [exp] 96 / 1e-25 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014763 [exp] 305 / 3e-107 AT1G63800 294 / 6e-103 ubiquitin-conjugating enzyme 5 (.1) Lus10036372 [exp] 294 / 1e-102 AT1G63800 286 / 9e-100 ubiquitin-conjugating enzyme 5 (.1) Lus10002359 [exp] 271 / 3e-93 AT1G63800 275 / 5e-95 ubiquitin-conjugating enzyme 5 (.1) Lus10032274 [exp] 263 / 7e-91 AT1G63800 278 / 5e-97 ubiquitin-conjugating enzyme 5 (.1) Lus10042136 [exp] 249 / 2e-85 AT1G63800 267 / 2e-92 ubiquitin-conjugating enzyme 5 (.1) Lus10024638 [exp] 220 / 8e-74 AT1G63800 229 / 2e-77 ubiquitin-conjugating enzyme 5 (.1) Lus10014187 [exp] 97 / 6e-26 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 97 / 6e-26 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027846 [exp] 97 / 7e-26 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10021385 [exp] 97 / 1e-25 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.014G086600.1 pacid=42763679 polypeptide=Potri.014G086600.1.p locus=Potri.014G086600 ID=Potri.014G086600.1.v4.1 annot-version=v4.1 ATGTCTTCCCCTAGCAAACGAAGAGAGATGGACTTGATGAAATTGATGATGAGTGATTACAAGGTAGAGCTGATCAATGATGGCATGCAAGAGTTTTATG TTCATTTCAATGGACCCAATGAAAGTCCTTACCATGGAGGTGTGTGGAGGATAAAGGTTGAGCTACCAGATGCGTATCCCTATAGATCTCCCTCAATAGG CTTTGTTAATAAGATCTACCATCCAAATGTTGATGAAATGTCTGGCTCAGTTTGTTTAGACGTTATTAATCAGACTTGGAGCCCCATGTTTGATTTGGTA AACGTGTTTGAAGTATTCATACCACAGCTGCTTTTGTATCCTAACCCATCAGATCCATTGAATGGCGAGGCTGCAGCTCTGATGATGCGTGACAAGCCTG CTTATGAGCTAAGAGTTAAAGAATACTGTGAGAAATATGCTAAGCCAGAGGACATTGGTGCTGCCCCAGAAGAAAACTCAAGTGACGAGGAGTTGAGTGA GGATGAGTACGAGTCTCTTGATGATGAAATGGCAGGCCAAGCAGATCCATAG
AA sequence Show only first row Show all	>Potri.014G086600.1 pacid=42763679 polypeptide=Potri.014G086600.1.p locus=Potri.014G086600 ID=Potri.014G086600.1.v4.1 annot-version=v4.1 MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIKVELPDAYPYRSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLV NVFEVFIPQLLLYPNPSDPLNGEAAALMMRDKPAYELRVKEYCEKYAKPEDIGAAPEENSSDEELSEDEYESLDDEMAGQADP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Potri.014G086600 [exp]	0	1	Pt-UBC4.2
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Potri.018G110700 [exp]	1.00	0.8981
AT1G02130		ARA5, AtRABD2a,...	ARABIDOPSIS THALIANA RAB D2A, ...		Potri.001G152800 [exp]	5.29	0.7704	Pt-RAB1.5
AT5G57860			Ubiquitin-like superfamily pro...		Potri.006G181400 [exp]	5.29	0.7962
AT3G28715			ATPase, V0/A0 complex, subunit...		Potri.017G079200 [exp]	6.92	0.8317
AT5G53300		UBC10	ubiquitin-conjugating enzyme 1...		Potri.012G033000 [exp]	9.16	0.7963	UBC9.1
AT4G39220		ATRER1A	Rer1 family protein (.1)		Potri.009G118500 [exp]	10.09	0.7652
AT4G34720		ATVHA-C1, AVA-P...	VACUOLAR H+-PUMPING ATPASE C1,...		Potri.009G125000 [exp]	11.22	0.8095	Pt-AVAP5.2
AT4G32930			unknown protein		Potri.006G233500 [exp]	12.32	0.7401
AT2G01600			ENTH/ANTH/VHS superfamily prot...		Potri.010G110000 [exp]	18.30	0.7211
AT4G33410		ATSPPL1	SIGNAL PEPTIDE PEPTIDASE-LIKE ...		Potri.012G142400 [exp]	19.36	0.8027

Compare expression of checked genes

Potri.014G086600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.