Pt-BRH1.1 (Potri.014G087700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-BRH1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61460 221 / 9e-75 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT1G63840 171 / 5e-55 RING/U-box superfamily protein (.1)
AT5G41400 142 / 1e-43 RING/U-box superfamily protein (.1)
AT4G11360 107 / 3e-30 RHA1B RING-H2 finger A1B (.1)
AT4G11370 102 / 4e-28 RHA1A RING-H2 finger A1A (.1)
AT4G00305 84 / 4e-21 RING/U-box superfamily protein (.1)
AT3G43430 72 / 3e-16 RING/U-box superfamily protein (.1)
AT5G20885 71 / 8e-16 RING/U-box superfamily protein (.1)
AT2G04240 62 / 1e-12 XERICO RING/U-box superfamily protein (.1.2)
AT5G43420 62 / 7e-12 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G161900 268 / 3e-93 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1)
Potri.003G130900 176 / 5e-57 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1)
Potri.001G101000 156 / 4e-49 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1)
Potri.006G217000 73 / 1e-16 AT5G20885 138 / 8e-42 RING/U-box superfamily protein (.1)
Potri.007G086300 71 / 6e-16 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.011G150800 70 / 2e-15 AT3G61460 69 / 1e-14 brassinosteroid-responsive RING-H2 (.1)
Potri.010G047100 68 / 4e-15 AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1)
Potri.005G081200 68 / 7e-15 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Potri.014G170400 67 / 2e-14 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036378 204 / 1e-67 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10032290 181 / 8e-59 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 176 / 6e-57 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10017510 149 / 4e-46 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1)
Lus10028773 146 / 3e-45 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1)
Lus10014758 73 / 2e-17 AT3G61460 71 / 7e-17 brassinosteroid-responsive RING-H2 (.1)
Lus10008283 72 / 7e-16 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1)
Lus10043353 63 / 2e-12 AT5G20885 157 / 4e-49 RING/U-box superfamily protein (.1)
Lus10019507 62 / 4e-12 AT5G20885 162 / 5e-51 RING/U-box superfamily protein (.1)
Lus10019973 63 / 5e-12 AT4G30400 252 / 4e-80 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.014G087700.1 pacid=42762277 polypeptide=Potri.014G087700.1.p locus=Potri.014G087700 ID=Potri.014G087700.1.v4.1 annot-version=v4.1
ATGGGGTTTCCAGTTGGGTACTCGGAGGTTTTGTTACCCAAGCTGTTCGTTCACGCACTTTCCTTGCTGGGTTTCATCCGGGGCCTCGTTTTGTGCCTTT
TTACCTATGTGGGTCTCTCAGATTTCCTTGAGACTGACAATATTTGGCCCGATTACCCGACCCGAACGTCCTTCTACCCGTCTCTATCGGCTGCCCTGAT
CCGGGAAATCTTGCCTGTCATCAAGTTCGAGGACTTGCTCGGCGGAGATGGTGGTTGTTGTGACTTGCCGGAGAGTTGTGCTGTTTGTTTGTATGAGTTT
GAAGGAGAGGATGAGATCAGGTGGTTGAAGAATTGTAAGCACATTTTTCACAGGGCTTGTTTGGACCGTTGGATGGATCATAACAGGAACACGTGTCCAC
TCTGTAGGACTTCGTTTGTGCCTGATGAGATGCAGGGGGAGTTTAATCAGCGGTTATGGGCCGCAAATAGCGATGATAGTGATTTTTACGATGAATAG
AA sequence
>Potri.014G087700.1 pacid=42762277 polypeptide=Potri.014G087700.1.p locus=Potri.014G087700 ID=Potri.014G087700.1.v4.1 annot-version=v4.1
MGFPVGYSEVLLPKLFVHALSLLGFIRGLVLCLFTYVGLSDFLETDNIWPDYPTRTSFYPSLSAALIREILPVIKFEDLLGGDGGCCDLPESCAVCLYEF
EGEDEIRWLKNCKHIFHRACLDRWMDHNRNTCPLCRTSFVPDEMQGEFNQRLWAANSDDSDFYDE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G61460 BRH1 brassinosteroid-responsive RIN... Potri.014G087700 0 1 Pt-BRH1.1
AT5G66720 Protein phosphatase 2C family ... Potri.001G381000 2.44 0.9039
AT1G19210 AP2_ERF Integrase-type DNA-binding sup... Potri.006G138800 2.64 0.9112 DREB47
AT2G45360 Protein of unknown function (D... Potri.003G115200 7.48 0.8900
AT3G15210 AP2_ERF ATERF4, RAP2.5... RELATED TO AP2 5, ethylene res... Potri.001G397200 7.48 0.8994
AT5G04820 OFP ATOFP13, OFP13 ARABIDOPSIS THALIANA OVATE FAM... Potri.009G161600 7.74 0.8962
AT1G27730 C2H2ZnF ZAT10, STZ salt tolerance zinc finger (.1... Potri.002G119300 8.83 0.9030
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Potri.004G200400 11.22 0.8945
AT5G51190 AP2_ERF Integrase-type DNA-binding sup... Potri.003G150800 15.19 0.8941 ERF5
AT2G41410 Calcium-binding EF-hand family... Potri.006G043700 18.33 0.8262
AT5G67080 MAPKKK19 mitogen-activated protein kina... Potri.005G139300 18.49 0.8889

Potri.014G087700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.