Potri.014G091000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61550 169 / 3e-53 RING/U-box superfamily protein (.1)
AT2G46160 167 / 2e-52 RING/U-box superfamily protein (.1)
AT2G35910 89 / 9e-22 RING/U-box superfamily protein (.1)
AT5G06490 86 / 6e-21 RING/U-box superfamily protein (.1)
AT5G07040 81 / 3e-19 RING/U-box superfamily protein (.1)
AT5G53110 82 / 3e-18 RING/U-box superfamily protein (.1)
AT2G25409 78 / 4e-18 unknown protein
AT2G20030 79 / 4e-17 RING/U-box superfamily protein (.1)
AT4G15975 77 / 4e-17 RING/U-box superfamily protein (.1)
AT4G33565 77 / 1e-16 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G165200 251 / 2e-85 AT3G61550 204 / 5e-67 RING/U-box superfamily protein (.1)
Potri.010G243400 95 / 2e-24 AT2G35910 152 / 4e-47 RING/U-box superfamily protein (.1)
Potri.006G201500 91 / 7e-23 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1)
Potri.016G067900 90 / 1e-22 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1)
Potri.008G019000 88 / 1e-21 AT5G06490 131 / 8e-39 RING/U-box superfamily protein (.1)
Potri.010G243200 85 / 1e-20 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1)
Potri.010G243500 84 / 2e-20 AT5G06490 113 / 6e-32 RING/U-box superfamily protein (.1)
Potri.010G243300 84 / 3e-20 AT2G35910 115 / 2e-32 RING/U-box superfamily protein (.1)
Potri.003G139900 86 / 2e-19 AT5G53110 253 / 3e-81 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041079 207 / 9e-68 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1)
Lus10036404 128 / 3e-38 AT3G61550 149 / 2e-46 RING/U-box superfamily protein (.1)
Lus10003400 78 / 4e-18 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1)
Lus10013618 81 / 6e-18 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1)
Lus10032382 81 / 1e-17 AT5G53110 237 / 1e-74 RING/U-box superfamily protein (.1)
Lus10024124 77 / 2e-17 AT5G07040 190 / 2e-62 RING/U-box superfamily protein (.1)
Lus10023086 79 / 4e-17 AT5G53110 161 / 1e-59 RING/U-box superfamily protein (.1)
Lus10019018 79 / 6e-17 AT5G53110 332 / 4e-112 RING/U-box superfamily protein (.1)
Lus10034953 77 / 1e-16 AT2G20030 278 / 2e-90 RING/U-box superfamily protein (.1)
Lus10015167 76 / 2e-16 AT3G05200 226 / 2e-71 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.014G091000.1 pacid=42764272 polypeptide=Potri.014G091000.1.p locus=Potri.014G091000 ID=Potri.014G091000.1.v4.1 annot-version=v4.1
ATGTCCACCCCCACCACCACAATCCCCTCCACTATCTCCGCCACCTCCCCTCCTCCCCCTGCTAATTACCTCACCAACCTTGGCCTTGGCTATTCTATAG
CCATAGCCCTTTTCTTTCTCGTACTTCTCTCCACTATCCTCCTTGCTTCTTACATATGTTGTCGCACCAACCGCCATCGTTCTCGTAACTCTAACAACAA
CAACAATAATTATGCAAACTCTACAGCTGATGGCATAATACTTCCTCGTATTATTTTCGTTGCCGAAGATGACGAAGAACAAGAACGTGATTTAGAAAGT
GCTGCTGTAGGTCTCAACCAGGCTGTTATCAACTCGTACCCGAAATTCCAGTTTAGTAAAGATGGTGGGTTCAGTGAAAGAACCAATAATTTTTGTAATA
CTTGCTCGATCTGTTTGTGCGAGTATAAAGATTTGGAGATGTTAAGAATGATGCCTGATTGTAGGCATTATTTTCACTTGCTTTGTCTTGATGCCTGGCT
TAAGCTTAATGGGTCGTGTCCCGTTTGTCGGAACTCACCGTTGCCTACTCCGCTTTCGACACCGTTGTCGGAGGTTGTGCCTTTGTCGCAGTACGCAGCG
GATCGGAGGAGGAGGTGA
AA sequence
>Potri.014G091000.1 pacid=42764272 polypeptide=Potri.014G091000.1.p locus=Potri.014G091000 ID=Potri.014G091000.1.v4.1 annot-version=v4.1
MSTPTTTIPSTISATSPPPPANYLTNLGLGYSIAIALFFLVLLSTILLASYICCRTNRHRSRNSNNNNNNYANSTADGIILPRIIFVAEDDEEQERDLES
AAVGLNQAVINSYPKFQFSKDGGFSERTNNFCNTCSICLCEYKDLEMLRMMPDCRHYFHLLCLDAWLKLNGSCPVCRNSPLPTPLSTPLSEVVPLSQYAA
DRRRR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G61550 RING/U-box superfamily protein... Potri.014G091000 0 1
AT2G39840 TOPP4 type one serine/threonine prot... Potri.010G071850 2.23 0.8740
AT3G48080 alpha/beta-Hydrolases superfam... Potri.012G074600 3.31 0.8175 EDS1.1
AT1G51940 protein kinase family protein ... Potri.008G187500 3.74 0.8671
AT1G76900 TUB AtTLP1 tubby like protein 1 (.1.2) Potri.005G192300 6.32 0.8332
AT1G04280 P-loop containing nucleoside t... Potri.008G162000 6.92 0.8521
AT1G54330 NAC ANAC020 NAC domain containing protein ... Potri.008G081500 6.92 0.8261
AT2G23450 Protein kinase superfamily pro... Potri.005G130900 10.58 0.8083
Potri.006G088700 11.53 0.8227
AT3G02600 ATLPP3, LPP3 lipid phosphate phosphatase 3 ... Potri.004G095400 12.24 0.7951 LPP3.2
AT5G53970 TAT7 tyrosine aminotransferase 7, T... Potri.017G014000 12.44 0.8328

Potri.014G091000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.