AGP20.1 (Potri.014G094800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol AGP20.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61640 42 / 7e-07 AGP20, ATAGP20 arabinogalactan protein 20 (.1)
AT2G46330 42 / 2e-06 ATAGP16, AGP16 arabinogalactan protein 16 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06376 AGP Arabinogalactan peptide
Representative CDS sequence
>Potri.014G094800.1 pacid=42764216 polypeptide=Potri.014G094800.1.p locus=Potri.014G094800 ID=Potri.014G094800.1.v4.1 annot-version=v4.1
ATGGCAGTTTGTGCTTCATTCAAGGCTTTTATTGCCGTTTTGGCTGTTGTTTCTCTTATTTTGGCTGTTGTCTCCCCTTCTGTTGAGGCCCAGTCTCCCG
CTCCCGCTCCTGCACCTACCAGCGATGGGACTTCAATCGACCAAGGAATCGCATACCTGCTGATGCTTGTGGCTCTGGTGCTCACATACCTGATCCACCC
GCTGGATGCTTCATCCTACACTTTCTTTTGA
AA sequence
>Potri.014G094800.1 pacid=42764216 polypeptide=Potri.014G094800.1.p locus=Potri.014G094800 ID=Potri.014G094800.1.v4.1 annot-version=v4.1
MAVCASFKAFIAVLAVVSLILAVVSPSVEAQSPAPAPAPTSDGTSIDQGIAYLLMLVALVLTYLIHPLDASSYTFF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G61640 AGP20, ATAGP20 arabinogalactan protein 20 (.1... Potri.014G094800 0 1 AGP20.1
AT3G08900 RGP3 reversibly glycosylated polype... Potri.008G097600 1.41 0.9514 Pt-RGP3.4
Potri.006G055800 1.73 0.9475
AT3G12110 ACT11 actin-11 (.1) Potri.006G192700 2.82 0.9501 Pt-ACT2.4
Potri.008G195700 4.47 0.9298
AT3G58120 bZIP ATBZIP61 Basic-leucine zipper (bZIP) tr... Potri.013G124400 5.09 0.9213
AT2G26520 unknown protein Potri.014G035400 5.38 0.9203
AT2G45470 AGP8, FLA8 FASCICLIN-like arabinogalactan... Potri.014G071700 5.47 0.9422 Pt-FLA8.1
AT5G04160 Nucleotide-sugar transporter f... Potri.006G046600 6.00 0.9377
AT4G12420 SKU5 Cupredoxin superfamily protein... Potri.003G112700 6.32 0.9468 Pt-SKU5.1
AT5G56540 ATAGP14, AGP14 arabinogalactan protein 14 (.1... Potri.013G057500 7.48 0.9337

Potri.014G094800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.