Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-HTR12.1,HTR904
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01370 158 / 4e-50 CENH3, HTR12 CENTROMERIC HISTONE H3, Histone superfamily protein (.1.2) AT5G65360 112 / 2e-32 Histone superfamily protein (.1) AT5G10400 112 / 2e-32 Histone superfamily protein (.1) AT5G10390 112 / 2e-32 Histone superfamily protein (.1) AT3G27360 112 / 2e-32 Histone superfamily protein (.1) AT1G09200 112 / 2e-32 Histone superfamily protein (.1) AT4G40040 111 / 3e-32 Histone superfamily protein (.1.2) AT4G40030 111 / 3e-32 Histone superfamily protein (.1.2.3) AT5G10980 111 / 3e-32 Histone superfamily protein (.1) AT1G19890 110 / 1e-31 ATMGH3, MGH3 male-gamete-specific histone H3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G016900 [exp] 112 / 2e-32 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.001G016700 [exp] 112 / 2e-32 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G207700 [exp] 112 / 2e-32 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G207852 [exp] 112 / 2e-32 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G210100 [exp] 112 / 2e-32 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.002G028800 [exp] 112 / 2e-32 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.014G096900 [exp] 112 / 2e-32 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.005G233900 [exp] 112 / 3e-32 AT5G65360 271 / 1e-95 Histone superfamily protein (.1) Potri.005G072300 [exp] 111 / 3e-32 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008119 [exp] 171 / 6e-56 AT1G01370 149 / 5e-47 CENTROMERIC HISTONE H3, Histone superfamily protein (.1.2) Lus10031822 [exp] 112 / 3e-32 AT5G10400 271 / 1e-95 Histone superfamily protein (.1) Lus10005271 [exp] 112 / 3e-32 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10005270 [exp] 112 / 3e-32 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10031250 [exp] 112 / 3e-32 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10025439 [exp] 112 / 3e-32 AT5G65360 271 / 1e-95 Histone superfamily protein (.1) Lus10012757 [exp] 110 / 6e-32 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3) Lus10031821 [exp] 113 / 7e-32 AT3G27360 273 / 3e-95 Histone superfamily protein (.1) Lus10012744 [exp] 111 / 7e-32 AT5G65360 271 / 2e-95 Histone superfamily protein (.1) Lus10000284 [exp] 110 / 8e-32 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF00125 [poplar] [flax] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Potri.014G096400.1 pacid=42764533 polypeptide=Potri.014G096400.1.p locus=Potri.014G096400 ID=Potri.014G096400.1.v4.1 annot-version=v4.1 ATGGCCAGAACGAAACATCCAGTTGCTCGAAAACGAGCCAGAAGCCCGAAGAGATCCGATGCCTCACCATCTACACCTAGAACGCCAACATCGTCGAGAA CAAGACCGCAAGCAAATGGCCAACAAGGTTCATCCACACAAAGGCAGAGGAAAAAGCATCGCTTCCGTTCAGGAACAGTAGCTCTTCGTGAAATTCGGCA ATATCAGAAAACTTGGAGGCCACTCATACCAGCTGCTAGCTTTATTCGATGTGTAAGAATGATTACTCAGGAGTTTTCCCGAGAAGTGAACCGTTGGACT GCTGAAGCTTTAGTTGCAATTCAGGAGGCAGCAGAGGATTTTTTGGTTCATTTGTTTGAAGATGGAATGCTCTGTGCAATTCATGCAAAACGGGTTACAT TAATGAAAAAGGATTTTGAGTTGGCCCGTCGGCTTGGAGGGAAGGGACGACCTTGGTGA
AA sequence Show only first row Show all	>Potri.014G096400.1 pacid=42764533 polypeptide=Potri.014G096400.1.p locus=Potri.014G096400 ID=Potri.014G096400.1.v4.1 annot-version=v4.1 MARTKHPVARKRARSPKRSDASPSTPRTPTSSRTRPQANGQQGSSTQRQRKKHRFRSGTVALREIRQYQKTWRPLIPAASFIRCVRMITQEFSREVNRWT AEALVAIQEAAEDFLVHLFEDGMLCAIHAKRVTLMKKDFELARRLGGKGRPW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01370		CENH3, HTR12	CENTROMERIC HISTONE H3, Histon...		Potri.014G096400 [exp]	0	1	Pt-HTR12.1,HTR904
AT3G09660		MCM8	minichromosome maintenance 8 (...		Potri.006G131900 [exp]	24.49	0.5774
AT4G29170		ATMND1	Mnd1 family protein (.1.2)		Potri.018G069800 [exp]	39.26	0.6128
AT3G19590		BUB3.1	BUB \(BUDDING UNINHIBITED BY B...		Potri.001G295100 [exp]	49.85	0.5664
AT5G14850			Alg9-like mannosyltransferase ...		Potri.018G098700 [exp]	54.58	0.5864
AT1G08450		AtCRT3, PSL1, E...	PRIORITY IN SWEET LIFE 1, EMS-...		Potri.017G026300 [exp]	77.07	0.5556
AT5G59240			Ribosomal protein S8e family p...		Potri.001G360500 [exp]	88.97	0.5566
AT5G63110		RPD3B, CAT1, AX...	RNA-MEDIATED TRANSCRIPTIONAL S...		Potri.015G082500 [exp]	156.33	0.4933
AT1G61000			unknown protein		Potri.017G043000 [exp]	185.37	0.4876

Compare expression of checked genes

Potri.014G096400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.