Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25120 47 / 5e-07 CYP71B11 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) AT5G25140 47 / 6e-07 CYP71B13 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) AT2G45550 45 / 2e-06 CYP76C4 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) AT5G25130 45 / 3e-06 CYP71B12 "cytochrome P450, family 71, subfamily B, polypeptide 12", cytochrome P450, family 71, subfamily B, polypeptide 12 (.1) AT5G25180 44 / 8e-06 CYP71B14 "cytochrome P450, family 71, subfamily B, polypeptide 14", cytochrome P450, family 71, subfamily B, polypeptide 14 (.1) AT2G24180 42 / 3e-05 CYP71B6 cytochrome p450 71b6 (.1) AT2G45560 42 / 3e-05 CYP76C1 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) AT5G57260 42 / 4e-05 CYP71B10 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) AT3G26180 42 / 5e-05 CYP71B20 "cytochrome P450, family 71, subfamily B, polypeptide 20", cytochrome P450, family 71, subfamily B, polypeptide 20 (.1.2) AT3G26330 40 / 0.0001 CYP71B37 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G171800 [exp] 62 / 4e-12 AT1G01280 778 / 0.0 "cytochrome P450, family 703, subfamily A, polypeptide 2", cytochrome P450, family 703, subfamily A, polypeptide 2 (.1) Potri.003G118200 [exp] 49 / 1e-07 AT2G45550 438 / 9e-150 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Potri.007G084800 [exp] 43 / 1e-05 AT3G26300 380 / 3e-127 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.002G150500 [exp] 41 / 8e-05 AT2G45550 497 / 5e-173 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Potri.005G029800 [exp] 41 / 8e-05 AT3G52970 626 / 0.0 "cytochrome P450, family 76, subfamily G, polypeptide 1", cytochrome P450, family 76, subfamily G, polypeptide 1 (.1.2) Potri.005G030100 [exp] 41 / 8e-05 AT3G52970 617 / 0.0 "cytochrome P450, family 76, subfamily G, polypeptide 1", cytochrome P450, family 76, subfamily G, polypeptide 1 (.1.2) Potri.015G085800 [exp] 41 / 9e-05 AT3G48270 479 / 7e-166 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) Potri.016G137600 [exp] 41 / 0.0001 AT3G48270 401 / 2e-135 "cytochrome P450, family 71, subfamily A, polypeptide 26", cytochrome P450, family 71, subfamily A, polypeptide 26 (.1) Potri.007G083300 [exp] 40 / 0.0001 AT3G26330 363 / 7e-121 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012624 [exp] 59 / 4e-11 AT1G01280 769 / 0.0 "cytochrome P450, family 703, subfamily A, polypeptide 2", cytochrome P450, family 703, subfamily A, polypeptide 2 (.1) Lus10028881 [exp] 46 / 2e-06 AT2G45550 477 / 4e-165 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10043311 [exp] 45 / 2e-06 AT3G48320 159 / 6e-46 "cytochrome P450, family 71, subfamily A, polypeptide 21", cytochrome P450, family 71, subfamily A, polypeptide 21 (.1) Lus10028852 [exp] 45 / 4e-06 AT2G45550 471 / 7e-163 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10021136 [exp] 44 / 8e-06 AT3G52970 436 / 5e-149 "cytochrome P450, family 76, subfamily G, polypeptide 1", cytochrome P450, family 76, subfamily G, polypeptide 1 (.1.2) Lus10028898 [exp] 44 / 9e-06 AT2G45550 488 / 1e-169 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10008935 [exp] 44 / 9e-06 AT2G45550 476 / 5e-165 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10008918 [exp] 44 / 1e-05 AT2G45550 483 / 1e-167 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10036079 [exp] 44 / 1e-05 AT2G45550 481 / 5e-167 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Lus10025749 [exp] 44 / 1e-05 AT3G52970 441 / 9e-151 "cytochrome P450, family 76, subfamily G, polypeptide 1", cytochrome P450, family 76, subfamily G, polypeptide 1 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G099600.2 pacid=42762281 polypeptide=Potri.014G099600.2.p locus=Potri.014G099600 ID=Potri.014G099600.2.v4.1 annot-version=v4.1 ATGGGCTCTTTGCGCTTGGCAGCAAGTAGAATCTTGCGAATATTAGCTTCCCTGGCGAAACAAAACAAGGCTGCTCATGGACCTTGTTGCCGCCCAGTGT TCAATCCTACTCTTCGTGGTTATTTGAAGTCACAGCATAAATCCATCAGGCTGCCTCCAGGCCCACCAAGATTGCCTGTATTCGGCAACCTTCTCCAGCT GGGTCAACAGCCTCATCAGGACGTAGCTTCTTTGTGTGATAAAAAAGAGGATCGAGTCCATTGCAAATCACCGTGCTGGCGAGGCCCAACAACTGGTCCA AGATGTCTGGGCCTGATCTCAAACAGAAAAGCCCGTGAGCTTGAGGGAAGTGCTTGGTGCATTTTCTATGAACAATGTGACTAG
AA sequence Show only first row Show all	>Potri.014G099600.2 pacid=42762281 polypeptide=Potri.014G099600.2.p locus=Potri.014G099600 ID=Potri.014G099600.2.v4.1 annot-version=v4.1 MGSLRLAASRILRILASLAKQNKAAHGPCCRPVFNPTLRGYLKSQHKSIRLPPGPPRLPVFGNLLQLGQQPHQDVASLCDKKEDRVHCKSPCWRGPTTGP RCLGLISNRKARELEGSAWCIFYEQCD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01280		CYP703A2	"cytochrome P450, family 703, ...		Potri.014G099600 [exp]	0	1
AT4G38040			Exostosin family protein (.1)		Potri.012G024150 [exp]	1.00	0.7795
					Potri.015G014150 [exp]	6.00	0.7395
AT1G64160			Disease resistance-responsive ...		Potri.001G096440 [exp]	6.63	0.6178
					Potri.015G021450 [exp]	8.83	0.7054
AT1G02790		PGA4	polygalacturonase 4 (.1)		Potri.010G011100 [exp]	11.40	0.6675
AT2G29620			unknown protein		Potri.009G043000 [exp]	20.49	0.5863
AT1G43760			DNAse I-like superfamily prote...		Potri.004G128901 [exp]	20.73	0.4965
AT5G18520			Lung seven transmembrane recep...		Potri.013G049500 [exp]	21.90	0.5148
					Potri.017G069350 [exp]	26.92	0.5284
					Potri.010G000901 [exp]	30.29	0.5675

Compare expression of checked genes

Potri.014G099600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.