Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR24
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46690 153 / 2e-49 SAUR-like auxin-responsive protein family (.1) AT4G00880 133 / 1e-41 SAUR-like auxin-responsive protein family (.1) AT3G61900 129 / 7e-40 SAUR-like auxin-responsive protein family (.1) AT5G53590 92 / 8e-25 SAUR-like auxin-responsive protein family (.1) AT4G12410 81 / 3e-20 SAUR-like auxin-responsive protein family (.1) AT4G22620 79 / 1e-19 SAUR-like auxin-responsive protein family (.1) AT3G60690 79 / 2e-19 SAUR-like auxin-responsive protein family (.1) AT2G45210 77 / 8e-19 SAUR-like auxin-responsive protein family (.1) AT5G20810 74 / 9e-18 SAUR-like auxin-responsive protein family (.1.2) AT3G43120 71 / 9e-17 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G176400 [exp] 177 / 3e-59 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 140 / 1e-44 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 137 / 4e-43 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.014G066900 [exp] 84 / 1e-21 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 83 / 4e-21 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 80 / 4e-20 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 72 / 1e-17 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 71 / 2e-17 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.019G002201 [exp] 70 / 8e-17 AT5G53590 74 / 8e-18 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010110 [exp] 112 / 3e-33 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10032949 [exp] 94 / 2e-25 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10008845 [exp] 90 / 5e-24 AT2G46690 102 / 4e-29 SAUR-like auxin-responsive protein family (.1) Lus10030295 [exp] 84 / 2e-21 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1) Lus10012613 [exp] 77 / 5e-20 AT2G46690 78 / 2e-20 SAUR-like auxin-responsive protein family (.1) Lus10009286 [exp] 78 / 5e-19 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10015879 [exp] 77 / 1e-18 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1) Lus10024600 [exp] 75 / 5e-18 AT4G12410 149 / 3e-46 SAUR-like auxin-responsive protein family (.1) Lus10032237 [exp] 75 / 7e-18 AT4G12410 149 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10028920 [exp] 73 / 7e-18 AT4G12410 106 / 1e-30 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.014G103300.1 pacid=42762427 polypeptide=Potri.014G103300.1.p locus=Potri.014G103300 ID=Potri.014G103300.1.v4.1 annot-version=v4.1 ATGGGTAGTGGAGAAAAGAGTCTGAGGAACTTTCACCTACACCTGCCTCATCTTCACCATCACAAGAAGCAAGCGAGAGATGTTCCGAAAGGGTGTTTGG CAATCAAGGTGGGTCAGGGAGAGGAGCAACAGAGATTTGTAGTGCCTGTCATATACTTCAATCACCCGCTCTTCATACAGTTATTGAAGGAAGCAGAAGA AGAATATGGCTTTGATCAAAAAGGCACCATCAGTATCCCTTGTCATGTGGAGGAGTTTAGGAACGTTCAAGGCATGATTGACAGGGAAAAGTCCATTCAC CATCACCATCTTGTTGGATGTTTTAGGGCTTGA
AA sequence Show only first row Show all	>Potri.014G103300.1 pacid=42762427 polypeptide=Potri.014G103300.1.p locus=Potri.014G103300 ID=Potri.014G103300.1.v4.1 annot-version=v4.1 MGSGEKSLRNFHLHLPHLHHHKKQARDVPKGCLAIKVGQGEEQQRFVVPVIYFNHPLFIQLLKEAEEEYGFDQKGTISIPCHVEEFRNVQGMIDREKSIH HHHLVGCFRA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46690			SAUR-like auxin-responsive pro...		Potri.014G103300 [exp]	0	1	SAUR24
AT1G24577			unknown protein		Potri.006G159300 [exp]	12.20	0.6672
AT1G23260		MMZ1 ,UEV1A	UBIQUITIN E2 VARIANT 1A, MMS Z...		Potri.010G107700 [exp]	21.00	0.6213
AT1G06330			Heavy metal transport/detoxifi...		Potri.002G005300 [exp]	21.26	0.6498
AT5G04870		AK1, ATCPK1, CP...	calcium dependent protein kina...		Potri.009G165700 [exp]	42.33	0.5688
AT3G61710		AtBECLIN1, ATAT...	BECLIN1, AUTOPHAGY 6 (.1.2.3)		Potri.002G170100 [exp]	45.74	0.5122
AT3G52420		ATOEP7	outer envelope membrane protei...		Potri.005G208100 [exp]	45.95	0.6019	OM14.1
AT1G76980			unknown protein		Potri.002G075400 [exp]	46.08	0.5619
AT4G15920		SWEET17, AtSWEE...	Nodulin MtN3 family protein (....		Potri.013G013900 [exp]	66.63	0.5569
AT5G51570			SPFH/Band 7/PHB domain-contain...		Potri.015G130600 [exp]	66.67	0.5179
AT5G42680			Protein of unknown function, D...		Potri.002G128800 [exp]	68.27	0.5499

Compare expression of checked genes

Potri.014G103300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.