Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26667 275 / 1e-94 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) AT3G60180 261 / 3e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT4G25280 239 / 7e-80 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G60961 180 / 3e-58 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G47840 104 / 3e-27 AMK2 adenosine monophosphate kinase (.1) AT5G35170 105 / 5e-26 adenylate kinase family protein (.1.2) AT5G63400 88 / 5e-21 ADK1 adenylate kinase 1 (.1.2) AT5G50370 83 / 3e-19 Adenylate kinase family protein (.1) AT2G37250 77 / 5e-17 ADK, ATPADK1 adenosine kinase (.1) AT2G39270 67 / 3e-13 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G134600 [exp] 283 / 8e-98 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Potri.014G043300 [exp] 281 / 2e-97 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Potri.015G129000 [exp] 243 / 1e-81 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.018G113400 [exp] 102 / 3e-25 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2) Potri.013G103400 [exp] 94 / 8e-23 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1) Potri.015G092800 [exp] 91 / 4e-22 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2) Potri.012G095300 [exp] 91 / 5e-22 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2) Potri.019G078200 [exp] 89 / 2e-21 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1) Potri.008G046100 [exp] 80 / 7e-18 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031611 [exp] 275 / 2e-94 AT5G26667 343 / 1e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10033733 [exp] 276 / 7e-94 AT5G26667 336 / 2e-117 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10031714 [exp] 228 / 3e-70 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031135 [exp] 209 / 3e-68 AT4G25280 263 / 3e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10019509 [exp] 179 / 1e-57 AT5G26667 217 / 5e-73 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10003504 [exp] 99 / 4e-25 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1) Lus10037995 [exp] 95 / 5e-24 AT5G47840 315 / 9e-110 adenosine monophosphate kinase (.1) Lus10016757 [exp] 93 / 8e-23 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2) Lus10009228 [exp] 93 / 1e-22 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1) Lus10009478 [exp] 90 / 1e-22 AT5G47840 293 / 1e-101 adenosine monophosphate kinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF13238 [poplar] [flax] AAA_18 AAA domain
Representative CDS sequence Show only first row Show all	>Potri.014G104700.1 pacid=42764681 polypeptide=Potri.014G104700.1.p locus=Potri.014G104700 ID=Potri.014G104700.1.v4.1 annot-version=v4.1 ATGGCGACTTCTGAATTCCCAGCTCAAAAGGATGGAAGCAAAGCTGTTTTACAGGAAACCACTGTGGTGGTATTTGTTTTAGGTGGTCCTGGTAGTGGAA AGGGCACTCAATGTCCCAAAATTGTTGAACACTTTGGGTTTAGACATCTTTGCGCCGGTGATCTTCTTCAAGCAGAAATCGAGTCTGAATCTGAAAATGG AACAATGATTCAAAACTTCAAGAAAGAAGGAAAGATTGTCCCTTCTGAGATAACTGTGAAGCTTCTACAACAGGCGATGCAGCAAAGTGATAACAAGAGA TTTATCATTGATGGTTTCTCGCGCAATGAGGAAAATCGTGCTGCATTCGAGAACATTGTGAGAATCAAGCCAGAATTTGTATTATTTTTTGATTGTCCTG AAGAGGAGTTGACAAAACGTATTCTGAACAGGAACCAGGGAAGGGTGGATGATAACATTGAAACCATAGGAAAGCGACTTAAAGTCTATTTCGAATCAAC CTTACCTGTAATCAACTACTACAACTCAAAGGGGAAGGTTCAGAAGATTGATGCTCAAAGATCAATTGAGGAGGTATTTGAGGATGTGAAGAGTGTTTTT GCCAAGCTCAGACCAGTGGCCAGGGTGGGATCAACGAAATAA
AA sequence Show only first row Show all	>Potri.014G104700.1 pacid=42764681 polypeptide=Potri.014G104700.1.p locus=Potri.014G104700 ID=Potri.014G104700.1.v4.1 annot-version=v4.1 MATSEFPAQKDGSKAVLQETTVVVFVLGGPGSGKGTQCPKIVEHFGFRHLCAGDLLQAEIESESENGTMIQNFKKEGKIVPSEITVKLLQQAMQQSDNKR FIIDGFSRNEENRAAFENIVRIKPEFVLFFDCPEEELTKRILNRNQGRVDDNIETIGKRLKVYFESTLPVINYYNSKGKVQKIDAQRSIEEVFEDVKSVF AKLRPVARVGSTK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G26667		PYR6	P-loop containing nucleoside t...		Potri.014G104700 [exp]	0	1
AT3G54860		ATVPS33	VACUOLAR PROTEIN SORTING 33, S...		Potri.010G226600 [exp]	4.58	0.7591
AT3G12530		PSF2	PSF2 (.1.2)		Potri.008G056200 [exp]	5.65	0.7691
AT5G05980		ATDFB, FPGS1	folylpolyglutamate synthetase ...		Potri.008G060600 [exp]	6.78	0.7738
AT4G10840			Tetratricopeptide repeat (TPR)...		Potri.002G173400 [exp]	38.70	0.7392
AT2G47360			unknown protein		Potri.002G195400 [exp]	62.22	0.7263
AT5G14230			unknown protein		Potri.001G333600 [exp]	100.15	0.6850
AT3G54800			Pleckstrin homology (PH) and l...		Potri.008G038800 [exp]	113.58	0.6795
AT5G27950			P-loop containing nucleoside t...		Potri.013G033900 [exp]	145.69	0.6560
AT1G68795		CLE12	CLAVATA3/ESR-RELATED 12 (.1)		Potri.010G130400 [exp]	156.84	0.6701	CLE12.1
AT1G26810		GALT1	galactosyltransferase1 (.1)		Potri.008G086900 [exp]	166.14	0.6348

Compare expression of checked genes

Potri.014G104700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.