Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61930 44 / 1e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G179000 [exp] 140 / 7e-45 AT3G61930 51 / 2e-09 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002685 [exp] 56 / 2e-11 AT3G61930 45 / 4e-07 unknown protein Lus10030203 [exp] 52 / 5e-10 AT3G61930 44 / 1e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G105000.1 pacid=42762863 polypeptide=Potri.014G105000.1.p locus=Potri.014G105000 ID=Potri.014G105000.1.v4.1 annot-version=v4.1 ATGGGGAATTGGTTTGCGAGGATTTACCAGGCGGTGCTCTCAGTTGACCAAGACAGCGAGGATGTTAAAAGCAGCCTCATTGCCCCATCATCAAGCAGCT TAAGAATCAAGGTCCGTATGACAACAACGCAACTAAAGGAGTTGATGACACAAGCGGATTTGAGCGAAGGCAACTCGGAGCTTGGTAGCATGATCCTCCA AGAATGCTTAGATGGCAGGTTTCGTGCTCGTGTTGTCGCTGGAGATGAAGGTTCGGTATCATCCGAATATGCAAAGAATTTATATACTATCAAGGAAGAG TAA
AA sequence Show only first row Show all	>Potri.014G105000.1 pacid=42762863 polypeptide=Potri.014G105000.1.p locus=Potri.014G105000 ID=Potri.014G105000.1.v4.1 annot-version=v4.1 MGNWFARIYQAVLSVDQDSEDVKSSLIAPSSSSLRIKVRMTTTQLKELMTQADLSEGNSELGSMILQECLDGRFRARVVAGDEGSVSSEYAKNLYTIKEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61930			unknown protein		Potri.014G105000 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Potri.017G152080 [exp]	2.64	0.9645
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.019G007600 [exp]	4.24	0.9553
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Potri.005G075400 [exp]	9.48	0.9468
AT1G64300			Protein kinase family protein ...		Potri.014G095200 [exp]	10.19	0.9410
AT2G30300			Major facilitator superfamily ...		Potri.013G154000 [exp]	11.40	0.9348
AT1G78270		ATUGT85A4	UDP-glucosyl transferase 85A4 ...		Potri.016G020201 [exp]	13.74	0.9448
AT2G30520		RPT2	ROOT PHOTOTROPISM 2, Phototrop...		Potri.019G131600 [exp]	14.83	0.9042	RPT2.3
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Potri.004G139700 [exp]	15.68	0.9128	FLS4,Pt-FLS.4
AT2G26580	YABBY	YAB5	YABBY5, plant-specific transcr...		Potri.006G067800 [exp]	18.24	0.9379
AT5G51110			Transcriptional coactivator/pt...		Potri.012G112400 [exp]	21.44	0.9255

Compare expression of checked genes

Potri.014G105000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.