Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24510 97 / 2e-27 60S acidic ribosomal protein family (.1) AT1G01100 93 / 7e-26 60S acidic ribosomal protein family (.1.2.3.4) AT5G47700 92 / 1e-25 60S acidic ribosomal protein family (.1.2) AT4G00810 92 / 1e-25 60S acidic ribosomal protein family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G179400 [exp] 105 / 1e-30 AT5G24510 99 / 3e-28 60S acidic ribosomal protein family (.1) Potri.015G004700 [exp] 101 / 3e-29 AT1G01100 96 / 4e-27 60S acidic ribosomal protein family (.1.2.3.4) Potri.012G021700 [exp] 100 / 8e-29 AT5G24510 94 / 3e-26 60S acidic ribosomal protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002680 [exp] 97 / 5e-27 AT5G24510 122 / 2e-37 60S acidic ribosomal protein family (.1) Lus10030200 [exp] 98 / 8e-25 AT1G05600 580 / 0.0 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10028876 [exp] 91 / 8e-25 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10008944 [exp] 91 / 8e-25 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10008943 [exp] 91 / 8e-25 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10034864 [exp] 90 / 8e-25 AT5G24510 114 / 2e-34 60S acidic ribosomal protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [poplar] [flax] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Potri.014G105400.4 pacid=42764442 polypeptide=Potri.014G105400.4.p locus=Potri.014G105400 ID=Potri.014G105400.4.v4.1 annot-version=v4.1 ATGTCCGGTAGCGAGCTTGCTTGCACTTACGCTGCTCTTATTCTCTTTGATGAGAACATCTCCATCACTGCAGAAAAGATTGCAACATTGGTGAAAGCAG CCAATGTGCAAATTGAATCTTACTGGCCAGGCTTATTTGCTAAGCTTGCTGAGAAGCGCAACATCGAGGACCTCATCATGAATGTTGGCTCTGGTGGTGG TGCTGCTGTTGCTGTTGCTGCCCCAGCTGGTGGTGCAACTGCCCCCGCCGATGCTCCCGCCGCTGAGGAGAAGAAGGAACCAGTTAAGGAGGAAAGTGAG GATGAAGACATGGGATTCAGCTTGTTTGATTAG
AA sequence Show only first row Show all	>Potri.014G105400.4 pacid=42764442 polypeptide=Potri.014G105400.4.p locus=Potri.014G105400 ID=Potri.014G105400.4.v4.1 annot-version=v4.1 MSGSELACTYAALILFDENISITAEKIATLVKAANVQIESYWPGLFAKLAEKRNIEDLIMNVGSGGGAAVAVAAPAGGATAPADAPAAEEKKEPVKEESE DEDMGFSLFD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24510			60S acidic ribosomal protein f...		Potri.014G105400 [exp]	0	1
AT4G14320			Zinc-binding ribosomal protein...		Potri.005G092500 [exp]	3.31	0.9701
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.005G211200 [exp]	5.09	0.9695
AT3G05590		RPL18	ribosomal protein L18 (.1)		Potri.014G127300 [exp]	7.74	0.9629	RPL18.10
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Potri.016G082300 [exp]	8.36	0.9578
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.010G167700 [exp]	8.83	0.9526
AT3G04840			Ribosomal protein S3Ae (.1)		Potri.008G156300 [exp]	9.16	0.9628	RS3.2
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.003G123101 [exp]	9.79	0.9603
AT4G16720			Ribosomal protein L23/L15e fam...		Potri.001G156100 [exp]	10.72	0.9609	RPL15.3
AT2G27710			60S acidic ribosomal protein f...		Potri.004G185800 [exp]	11.22	0.9601
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Potri.005G080700 [exp]	11.22	0.9592

Compare expression of checked genes

Potri.014G105400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.