Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35580 175 / 1e-51 NAC NTL9, CBNAC NAC transcription factor-like 9 (.1.2.3) AT1G33060 160 / 3e-45 NAC ANAC014 NAC 014 (.1.2) AT5G24590 154 / 4e-44 NAC TIP, ANAC091 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) AT3G49530 149 / 5e-42 NAC NTL6, ANAC062 NTM1 \(NAC WITH TRANSMEMBRANE MOTIF 1\)-LIKE 6, NAC domain containing protein 62 (.1) AT3G17730 139 / 3e-40 NAC ANAC057 NAC domain containing protein 57 (.1) AT5G17260 142 / 2e-39 NAC ANAC086 NAC domain containing protein 86 (.1) AT3G03200 141 / 3e-39 NAC ANAC045 NAC domain containing protein 45 (.1) AT4G01550 141 / 3e-39 NAC ANAC069, NTM2 NAC with Transmembrane Motif 2, NAC domain containing protein 69 (.1.2) AT4G17980 136 / 4e-39 NAC ANAC071 NAC domain containing protein 71 (.1) AT2G17040 133 / 9e-38 NAC ANAC036 NAC domain containing protein 36 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G107700 [exp] 472 / 6e-171 AT4G35580 178 / 2e-52 NAC transcription factor-like 9 (.1.2.3) Potri.014G107900 [exp] 459 / 2e-166 AT4G35580 183 / 7e-55 NAC transcription factor-like 9 (.1.2.3) Potri.002G182000 [exp] 319 / 5e-111 AT4G35580 186 / 9e-56 NAC transcription factor-like 9 (.1.2.3) Potri.002G182300 [exp] 316 / 7e-110 AT4G35580 184 / 4e-55 NAC transcription factor-like 9 (.1.2.3) Potri.002G154200 [exp] 249 / 4e-84 AT4G35580 169 / 5e-50 NAC transcription factor-like 9 (.1.2.3) Potri.014G076000 [exp] 223 / 8e-74 AT4G35580 161 / 5e-47 NAC transcription factor-like 9 (.1.2.3) Potri.011G149300 [exp] 172 / 2e-49 AT1G33060 387 / 2e-125 NAC 014 (.1.2) Potri.012G007500 [exp] 165 / 3e-47 AT5G24590 306 / 4e-98 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Potri.015G004100 [exp] 159 / 3e-45 AT3G49530 309 / 5e-99 NTM1 \(NAC WITH TRANSMEMBRANE MOTIF 1\)-LIKE 6, NAC domain containing protein 62 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030174 [exp] 200 / 4e-64 AT4G35580 152 / 5e-43 NAC transcription factor-like 9 (.1.2.3) Lus10005144 [exp] 190 / 4e-60 AT4G35580 142 / 3e-39 NAC transcription factor-like 9 (.1.2.3) Lus10010148 [exp] 171 / 1e-49 AT4G35580 325 / 9e-105 NAC transcription factor-like 9 (.1.2.3) Lus10008285 [exp] 169 / 7e-49 AT4G35580 421 / 2e-142 NAC transcription factor-like 9 (.1.2.3) Lus10033251 [exp] 169 / 8e-49 AT4G35580 410 / 5e-138 NAC transcription factor-like 9 (.1.2.3) Lus10015587 [exp] 160 / 1e-45 AT5G24590 306 / 9e-99 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Lus10032919 [exp] 158 / 4e-45 AT5G24590 314 / 7e-102 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Lus10035373 [exp] 144 / 5e-41 AT4G17980 280 / 2e-93 NAC domain containing protein 71 (.1) Lus10042284 [exp] 142 / 1e-40 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10030978 [exp] 142 / 2e-40 AT4G17980 273 / 6e-91 NAC domain containing protein 71 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.014G108000.1 pacid=42762662 polypeptide=Potri.014G108000.1.p locus=Potri.014G108000 ID=Potri.014G108000.1.v4.1 annot-version=v4.1 ATGAATTCTCGACCACCTCCCGTAGGCTATGGATTCCATCCAACCGATGAAGAATTGGTGACCTATTACTTGAGGTTTAAAATGCACGGTGGCTATGAAC AAGAAGTCAGCATAATCGCAGAGGCTAATGTGTGCGATTATGAGCCTTGGGTTCTGCCTGAGCTTTCAGCAATTAAAGAGCCAAACGACCCAGAGTGTTA TTTCTTCTGTCCTCGCAGTTACAAGTACGCAAATAGCGACCGGGCTAATAGGACAACTCAAGCTGGATACTGGAAAGTCACAGGCAAGGATCGTATAGTC AAAACTAAAACCACCAAGGAGCATATTGCTACCAAGAAGACTCTGGTTTTCTACAAGGGGCGTGTTCCTAACGGGATCAAGACCGATTGGATCATGCACG AGTACCATCCAAACTTCAGCTTCCCTAACCAGAGGGAATTCGTTCTCTGCAAACTGAAGAAAGATCCACATGCGATCAAGCCAACATATGAAGAAGGTGA AGCAAGCTTCAATGTAACTTCTGATCATTCTGAAAATCAAAACTCAACTGAGTGTCATCATCCCCAAACCTTTGAAGAAGGTGAATATGGTGCCTGGACG GTTTCTAATTTCACTAACAACGAGCCAGAGGAAGATACTTATCAATTCCAAGCACAACTGGACTCATTGCGTGGCTACGATATTGAGGGATGTTATAGCC TGGACTCTGCCCTACAGTTTCCATACGGGGATATTTACTGA
AA sequence Show only first row Show all	>Potri.014G108000.1 pacid=42762662 polypeptide=Potri.014G108000.1.p locus=Potri.014G108000 ID=Potri.014G108000.1.v4.1 annot-version=v4.1 MNSRPPPVGYGFHPTDEELVTYYLRFKMHGGYEQEVSIIAEANVCDYEPWVLPELSAIKEPNDPECYFFCPRSYKYANSDRANRTTQAGYWKVTGKDRIV KTKTTKEHIATKKTLVFYKGRVPNGIKTDWIMHEYHPNFSFPNQREFVLCKLKKDPHAIKPTYEEGEASFNVTSDHSENQNSTECHHPQTFEEGEYGAWT VSNFTNNEPEEDTYQFQAQLDSLRGYDIEGCYSLDSALQFPYGDIY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Potri.014G108000 [exp]	0	1
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Potri.014G107700 [exp]	1.00	0.9266
AT5G63120			P-loop containing nucleoside t...		Potri.012G084600 [exp]	2.00	0.7094
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Potri.014G107900 [exp]	5.19	0.7988
AT5G54130			Calcium-binding endonuclease/e...		Potri.014G108200 [exp]	23.23	0.6241
					Potri.003G214400 [exp]	35.36	0.6554
AT2G17880			Chaperone DnaJ-domain superfam...		Potri.002G020800 [exp]	44.28	0.6127
AT5G55130		SIR1, CNX5	SIRTINOL RESISTANT 1, "co-fact...		Potri.001G355800 [exp]	54.89	0.5806	Pt-CNX5.1
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Potri.001G303800 [exp]	168.56	0.5585
AT4G22140		EBS	EARLY BOLTING IN SHORT DAYS, P...		Potri.014G157100 [exp]	177.82	0.5631
AT1G62340		ALE1	ABNORMAL LEAF-SHAPE 1, ABNORMA...		Potri.011G010700 [exp]	180.26	0.5769	Pt-ALE.2

Compare expression of checked genes

Potri.014G108000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.