Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01575 56 / 2e-11 serine protease inhibitor, Kazal-type family protein (.1) AT3G61980 52 / 5e-10 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G108900 [exp] 113 / 9e-35 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G109000 [exp] 105 / 2e-31 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108700 [exp] 62 / 2e-14 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1) Potri.015G001800 [exp] 52 / 5e-10 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108600 [exp] 51 / 1e-09 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.002G182800 [exp] 46 / 8e-08 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010287 [exp] 57 / 5e-12 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1) Lus10010285 [exp] 55 / 2e-11 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1) Lus10010094 [exp] 54 / 6e-11 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10009866 [exp] 52 / 2e-10 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Lus10030166 [exp] 53 / 3e-10 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1) Lus10007864 [exp] 53 / 3e-10 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1) Lus10010286 [exp] 50 / 7e-10 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1) Lus10009865 [exp] 49 / 3e-09 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1) Lus10030164 [exp] 46 / 4e-08 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G108800.1 pacid=42763031 polypeptide=Potri.014G108800.1.p locus=Potri.014G108800 ID=Potri.014G108800.1.v4.1 annot-version=v4.1 ATGGCCACCTCCAAGATCTTAGCACCCTTATGTTTGATGGTCCTCGTTTTCGGTCTTTGCTTGTCAATGGTTGAATCTCAAAGTTATGGTGTGTGTGAAG GATTCGATCCTGAAGCACCTCGATGCGCAGTTAGATGCAGCGTTCCTGACTATGTTTGTGGGACTGACGGTGTCACCTACACTTGTGGTTGCAAAGACGC TTTCTGCAATGGTGTTGATGTTGTCAAGAAAGGGAAATGCTAG
AA sequence Show only first row Show all	>Potri.014G108800.1 pacid=42763031 polypeptide=Potri.014G108800.1.p locus=Potri.014G108800 ID=Potri.014G108800.1.v4.1 annot-version=v4.1 MATSKILAPLCLMVLVFGLCLSMVESQSYGVCEGFDPEAPRCAVRCSVPDYVCGTDGVTYTCGCKDAFCNGVDVVKKGKC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G01575			serine protease inhibitor, Kaz...		Potri.014G108800 [exp]	0	1
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Potri.013G047950 [exp]	4.12	0.9300
AT5G42830			HXXXD-type acyl-transferase fa...		Potri.014G025600 [exp]	6.48	0.9126
AT3G03380		DEG7, DEGP7	degradation of periplasmic pro...		Potri.004G088700 [exp]	6.63	0.9015
AT3G45070			P-loop containing nucleoside t...		Potri.010G138450 [exp]	6.78	0.9162
AT2G18370			Bifunctional inhibitor/lipid-t...		Potri.001G232900 [exp]	6.92	0.9135
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Potri.010G165300 [exp]	10.24	0.9142
AT3G57230	MADS	AGL16	AGAMOUS-like 16 (.1.2)		Potri.002G109601 [exp]	10.39	0.9147
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Potri.016G023340 [exp]	12.24	0.9037
AT1G51920			unknown protein		Potri.003G061200 [exp]	12.44	0.8731
AT2G23620		ATMES1	ARABIDOPSIS THALIANA METHYL ES...		Potri.007G037700 [exp]	13.41	0.8993	HNL.2

Compare expression of checked genes

Potri.014G108800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.