Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61980 67 / 6e-16 serine protease inhibitor, Kazal-type family protein (.1) AT4G01575 61 / 3e-13 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G109000 [exp] 130 / 1e-41 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108800 [exp] 113 / 1e-34 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108700 [exp] 69 / 3e-17 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108600 [exp] 59 / 1e-12 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.002G182800 [exp] 57 / 8e-12 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.015G001800 [exp] 54 / 1e-10 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010287 [exp] 67 / 5e-16 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1) Lus10030166 [exp] 67 / 1e-15 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1) Lus10009866 [exp] 66 / 1e-15 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Lus10007864 [exp] 67 / 2e-15 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1) Lus10010094 [exp] 62 / 4e-14 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10009865 [exp] 59 / 7e-13 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1) Lus10010285 [exp] 58 / 2e-12 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1) Lus10010286 [exp] 50 / 1e-09 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1) Lus10030164 [exp] 48 / 9e-09 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G108900.1 pacid=42763359 polypeptide=Potri.014G108900.1.p locus=Potri.014G108900 ID=Potri.014G108900.1.v4.1 annot-version=v4.1 ATGGCCACCTCCAAAATCGTAGCACCCTTATGCTTGATGGTCCTCGTTTTCTGTCTTTCCTTGTCAATGGTTAAATCTCAAAGTTACGGTGTGTGTGCAG GAGCCGCACGCCCCGATCCAGAAACAATTCCATGCACAATTAACTGTTTGGTTGCTGACCCTGTTTGTGGGACTGACGGTGTCACCTACACTTGTGGTTG CTATGACGCTTTCTGCCATGGTGTTGAAGTTGTCAAGAAAGGGGAGTGCTAG
AA sequence Show only first row Show all	>Potri.014G108900.1 pacid=42763359 polypeptide=Potri.014G108900.1.p locus=Potri.014G108900 ID=Potri.014G108900.1.v4.1 annot-version=v4.1 MATSKIVAPLCLMVLVFCLSLSMVKSQSYGVCAGAARPDPETIPCTINCLVADPVCGTDGVTYTCGCYDAFCHGVEVVKKGEC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61980			serine protease inhibitor, Kaz...		Potri.014G108900 [exp]	0	1
AT2G19800		MIOX2	myo-inositol oxygenase 2 (.1)		Potri.017G100200 [exp]	2.00	0.9433
AT3G04945		LCR18	low-molecular-weight cysteine-...		Potri.013G032700 [exp]	5.29	0.9111
AT2G02220		ATPSKR1	phytosulfokin receptor 1 (.1)		Potri.010G097700 [exp]	5.29	0.9226	PSKR.1
AT4G26200		ACS7, ATACS7	1-amino-cyclopropane-1-carboxy...		Potri.018G067000 [exp]	6.00	0.9257	Pt-ACS3.2
AT3G27150			Galactose oxidase/kelch repeat...		Potri.017G069500 [exp]	6.32	0.9180
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120600 [exp]	9.16	0.9039
AT2G38870			Serine protease inhibitor, pot...		Potri.016G079050 [exp]	9.89	0.9005
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.010G075300 [exp]	10.58	0.9071
AT1G31050	bHLH	bHLH111	basic helix-loop-helix (bHLH) ...		Potri.010G098900 [exp]	11.87	0.8722
AT3G47570			Leucine-rich repeat protein ki...		Potri.006G273001 [exp]	14.45	0.8937

Compare expression of checked genes

Potri.014G108900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.