Potri.014G109801 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02305 515 / 0 Cysteine proteinases superfamily protein (.1)
AT4G01610 512 / 0 Cysteine proteinases superfamily protein (.1.2)
AT1G02300 489 / 3e-174 Cysteine proteinases superfamily protein (.1)
AT3G45310 117 / 1e-29 Cysteine proteinases superfamily protein (.1.2)
AT5G60360 112 / 8e-28 SAG2, AALP SENESCENCE ASSOCIATED GENE2, aleurain-like protease (.1.2.3)
AT3G19400 109 / 7e-27 Cysteine proteinases superfamily protein (.1.2)
AT3G43960 105 / 3e-25 Cysteine proteinases superfamily protein (.1)
AT1G29080 100 / 7e-24 Papain family cysteine protease (.1)
AT4G39090 99 / 4e-23 EMB3005, RD19A, RD19 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
AT2G34080 98 / 6e-23 Cysteine proteinases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G184201 669 / 0 AT1G02305 500 / 9e-179 Cysteine proteinases superfamily protein (.1)
Potri.002G184300 593 / 0 AT1G02305 550 / 0.0 Cysteine proteinases superfamily protein (.1)
Potri.006G141700 117 / 1e-29 AT3G45310 590 / 0.0 Cysteine proteinases superfamily protein (.1.2)
Potri.004G055900 107 / 2e-26 AT5G45890 438 / 5e-155 senescence-associated gene 12 (.1)
Potri.004G056000 107 / 3e-26 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1)
Potri.004G056500 107 / 3e-26 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1)
Potri.004G056100 106 / 8e-26 AT5G45890 419 / 2e-147 senescence-associated gene 12 (.1)
Potri.008G183100 106 / 9e-26 AT5G50260 489 / 2e-174 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.004G056366 105 / 9e-26 AT5G45890 416 / 5e-146 senescence-associated gene 12 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007212 545 / 0 AT1G02305 532 / 0.0 Cysteine proteinases superfamily protein (.1)
Lus10010091 529 / 0 AT1G02305 520 / 0.0 Cysteine proteinases superfamily protein (.1)
Lus10042693 112 / 3e-28 AT5G45890 379 / 1e-131 senescence-associated gene 12 (.1)
Lus10029658 111 / 1e-27 AT5G45890 383 / 4e-133 senescence-associated gene 12 (.1)
Lus10042691 106 / 1e-26 AT5G50260 321 / 5e-110 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10033428 108 / 2e-26 AT3G45310 565 / 0.0 Cysteine proteinases superfamily protein (.1.2)
Lus10029649 102 / 3e-24 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Lus10015286 99 / 5e-23 AT5G45890 393 / 7e-137 senescence-associated gene 12 (.1)
Lus10015285 96 / 4e-22 AT5G45890 406 / 8e-143 senescence-associated gene 12 (.1)
Lus10002184 96 / 4e-22 AT1G06260 384 / 1e-133 Cysteine proteinases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
CL0125 PF08127 Propeptide_C1 Peptidase family C1 propeptide
Representative CDS sequence
>Potri.014G109801.2 pacid=42764025 polypeptide=Potri.014G109801.2.p locus=Potri.014G109801 ID=Potri.014G109801.2.v4.1 annot-version=v4.1
ATGGCAAATCCTTTGTATTTTCCCACTCTTCTCTTACTCCTTGCTGCTATCTCTCAGGCTACTGCGGAGGAACCAGTCTCCAAGCTCAAACTCAACTCTA
GGATCCTTCAGGATTCAATAGTTCAAAAGGTCAATGAAAATCCCAAAGCTGGATGGGAAGCTACAATGAACCCTCAATTTTCCAATTATTCTGTTGGAGA
ATTTAAGTACCTTCTTGGAGTCAAACAAACACCCAGAAAGGAACTAAGAGGCGTTCCTCTTTTAAGGCATCCAAAATCCATGAAATTGCCAATAGAATTT
GATGCGAGAACTGCTTGGCCACATTGTAGCACCATCGGAAGAATTCTAGATCAGGGTCACTGTGGATCCTGTTGGGCATTTGGTGCTGTTGAATCACTAT
CTGATCGTTTTTGCATCCATTATGGCATGAACCTCTCTCTATCTGTCAATGATCTCTTAGCTTGCTGTGGCTGGATGTGCGGCGCTGGTTGCGATGGTGG
TAGTCCAATTGATGCATGGAGATACTTTGTCCAATCTGGTGTTGTCACTGAGGAGTGTGATCCATACTTTGATGATATTGGCTGTTCTCACCCTGGTTGC
GAACCAGGATTTCCTACTCCAAAGTGTGAGAGAAAGTGTGCTGATAAGAACAAACTCTGGGCGGAGTCAAAGCACTTCAGTGTTAATGCATATAGAATCG
ATTCTGACCCCCACAGTATTATGGCAGAAGTTTCTAGCAACGGACCAGTAGAGGTTGCCTTCACTGTTTATGAGGATTTTGCTCATTATAAATCAGGAGT
TTACAAGCACATAACAGGTGATGCCATGGGAGGCCATGCTGTTAAGCTTATTGGGTGGGGGACTTCTGAAGATGGGGAGGATTATTGGCTTCTTGCTAAT
CAGTGGAATAGAGGCTGGGGTGATGATGGTTACTTTAAGATTAAAAGAGGAACAAATGAGTGCGGCATTGAAGGGGCTGTTGTTGCTGGTTTGCCTTCCA
CCAGGAACCTCGTTAGAGAAGTTGCCAGCATCGATGGCCATGAGCACGCTACGGCTTGA
AA sequence
>Potri.014G109801.2 pacid=42764025 polypeptide=Potri.014G109801.2.p locus=Potri.014G109801 ID=Potri.014G109801.2.v4.1 annot-version=v4.1
MANPLYFPTLLLLLAAISQATAEEPVSKLKLNSRILQDSIVQKVNENPKAGWEATMNPQFSNYSVGEFKYLLGVKQTPRKELRGVPLLRHPKSMKLPIEF
DARTAWPHCSTIGRILDQGHCGSCWAFGAVESLSDRFCIHYGMNLSLSVNDLLACCGWMCGAGCDGGSPIDAWRYFVQSGVVTEECDPYFDDIGCSHPGC
EPGFPTPKCERKCADKNKLWAESKHFSVNAYRIDSDPHSIMAEVSSNGPVEVAFTVYEDFAHYKSGVYKHITGDAMGGHAVKLIGWGTSEDGEDYWLLAN
QWNRGWGDDGYFKIKRGTNECGIEGAVVAGLPSTRNLVREVASIDGHEHATA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G02305 Cysteine proteinases superfami... Potri.014G109801 0 1
AT1G09580 emp24/gp25L/p24 family/GOLD fa... Potri.003G019300 4.89 0.8044
AT1G77610 EamA-like transporter family p... Potri.002G084500 6.08 0.8450
AT2G40280 S-adenosyl-L-methionine-depend... Potri.010G185000 14.35 0.8348
AT3G63530 BB2, BB BIG BROTHER, RING/U-box superf... Potri.009G062100 17.66 0.7138
AT4G01575 serine protease inhibitor, Kaz... Potri.015G001800 17.91 0.8205
AT5G44670 Domain of unknown function (DU... Potri.003G156600 18.22 0.8188
AT3G24160 PMP putative type 1 membrane prote... Potri.003G178400 19.79 0.8038 Pt-PMP.2
AT2G40320 TBL33 TRICHOME BIREFRINGENCE-LIKE 33... Potri.008G073300 21.33 0.8126
AT5G43150 unknown protein Potri.010G088200 21.67 0.8180
Potri.013G151333 24.59 0.8052

Potri.014G109801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.