Potri.014G110600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G01650 257 / 2e-86 Polyketide cyclase / dehydrase and lipid transport protein (.1.2)
AT5G08720 97 / 2e-22 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G185100 383 / 7e-135 AT4G01650 246 / 9e-82 Polyketide cyclase / dehydrase and lipid transport protein (.1.2)
Potri.005G070700 87 / 5e-19 AT5G08720 906 / 0.0 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007203 293 / 5e-99 AT4G01650 257 / 5e-86 Polyketide cyclase / dehydrase and lipid transport protein (.1.2)
Lus10010086 291 / 1e-98 AT4G01650 257 / 2e-86 Polyketide cyclase / dehydrase and lipid transport protein (.1.2)
Lus10035962 88 / 3e-19 AT5G08720 855 / 0.0 unknown protein
Lus10025701 86 / 1e-18 AT5G08720 832 / 0.0 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Potri.014G110600.1 pacid=42764778 polypeptide=Potri.014G110600.1.p locus=Potri.014G110600 ID=Potri.014G110600.1.v4.1 annot-version=v4.1
ATGCGCGCCTTTGCAGTCCCAATAGACTATTACTACTGCTGCTACTCCTCTTATCCTTGTCTCTTGCTCCCACCGTCTTTCACTAACACCAAGCTCTCTT
CTTTCCATCCTAAATTCGCTAGCCTTAGCTCACATGCAACGCACCGCCTTCCATCCCAATTCAGACCCACCAGGCTTCGTTGTTCAAATTCCGGGTCGTC
CACATTTCTGGACGGGGATGATGATGATGGGTATTGTTCTTATGCAGGTGAGGAGGAGTCGGGAGATAGTGTAAGAGAGGATGGTGTTTTTATAGAGATA
AAGAAGCTTCAAAAGAATTCGAGGAGAATTCGGTCCAAGATTTCCATAAATGCTAGCCTTGACACTGTGTGGAAGATTTTAACTGATTATGAGAAGTTGG
CTGATTTCATTCCTGGTCTTGCCGTCAGCAAATTGATTGACAAGAAAGACAAATTCGCTCGTCTTTATCAGATTGGACAGCAAAACTTGGCATTTGGCCT
AAAATTTAATGCAAAAGCAATTTTGGATTGTTATGAGAGAGATCTTCAGACTCTTGCTTCTGGGGAAAAGCGTGATATTGAATTTAAGATGACAGAAGGT
GACTTTCAGTTTTTTGAAGGAATGTGGTCTATTGAACAGCTTGCTAAACCCAAAACTGAAGATTCCGTTGGTCAAGAGTATGAGACAACTCTTTCATATT
TGGTGGATGTAAAGCCTAAGATGTGGTTGCCTGTTAACCTAATTGAAGGTAGAATCTGCAAGGAGATAAAATCAAATCTCACATGCATCCGAGAAGAAGC
ACAGAAAGTGATTGATGATGCTCAGCATGACCAATAG
AA sequence
>Potri.014G110600.1 pacid=42764778 polypeptide=Potri.014G110600.1.p locus=Potri.014G110600 ID=Potri.014G110600.1.v4.1 annot-version=v4.1
MRAFAVPIDYYYCCYSSYPCLLLPPSFTNTKLSSFHPKFASLSSHATHRLPSQFRPTRLRCSNSGSSTFLDGDDDDGYCSYAGEEESGDSVREDGVFIEI
KKLQKNSRRIRSKISINASLDTVWKILTDYEKLADFIPGLAVSKLIDKKDKFARLYQIGQQNLAFGLKFNAKAILDCYERDLQTLASGEKRDIEFKMTEG
DFQFFEGMWSIEQLAKPKTEDSVGQEYETTLSYLVDVKPKMWLPVNLIEGRICKEIKSNLTCIREEAQKVIDDAQHDQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G01650 Polyketide cyclase / dehydrase... Potri.014G110600 0 1
AT2G44920 Tetratricopeptide repeat (TPR)... Potri.008G058800 1.00 0.9802
AT3G06730 TRXz, TRXP ,TRX... thioredoxin putative plastidic... Potri.001G028500 2.82 0.9795
AT5G66520 Tetratricopeptide repeat (TPR)... Potri.004G237000 3.46 0.9717
AT3G03630 CS26 cysteine synthase 26 (.1) Potri.019G045800 3.46 0.9765
AT5G17870 PSRP6 plastid-specific 50S ribosomal... Potri.002G112500 3.74 0.9612
AT5G63100 S-adenosyl-L-methionine-depend... Potri.015G082432 4.89 0.9639
AT4G24175 unknown protein Potri.005G240800 5.00 0.9670
AT3G11570 TBL8 TRICHOME BIREFRINGENCE-LIKE 8 ... Potri.016G074800 6.70 0.9546
AT4G29400 Protein of unknown function (D... Potri.014G148300 8.00 0.9580
AT5G17660 tRNA (guanine-N-7) methyltrans... Potri.013G070800 9.94 0.9508

Potri.014G110600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.