Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-IAA4.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62100 151 / 7e-47 AUX_IAA IAA30 indole-3-acetic acid inducible 30 (.1) AT2G46990 137 / 2e-41 AUX_IAA IAA20 indole-3-acetic acid inducible 20 (.1) AT3G17600 130 / 8e-39 AUX_IAA IAA31 indole-3-acetic acid inducible 31 (.1) AT1G04240 102 / 2e-27 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT5G43700 100 / 7e-27 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT4G28640 98 / 3e-25 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT3G15540 95 / 2e-24 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1) AT2G33310 95 / 3e-24 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT1G04550 94 / 1e-23 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT3G23030 89 / 1e-22 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G186400 [exp] 252 / 9e-87 AT3G62100 147 / 3e-45 indole-3-acetic acid inducible 30 (.1) Potri.013G041300 [exp] 108 / 5e-30 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 107 / 2e-29 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161100 [exp] 99 / 9e-26 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G218200 [exp] 97 / 1e-25 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 94 / 2e-24 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.001G177500 [exp] 94 / 2e-24 AT3G15540 224 / 4e-75 MASSUGU 2, indole-3-acetic acid inducible 19 (.1) Potri.010G065200 [exp] 94 / 1e-23 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.002G108000 [exp] 95 / 3e-23 AT5G65670 355 / 4e-122 indole-3-acetic acid inducible 9 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009967 [exp] 147 / 1e-45 AT3G62100 128 / 2e-38 indole-3-acetic acid inducible 30 (.1) Lus10038025 [exp] 144 / 4e-44 AT3G62100 127 / 1e-37 indole-3-acetic acid inducible 30 (.1) Lus10007193 [exp] 139 / 2e-42 AT3G62100 117 / 4e-34 indole-3-acetic acid inducible 30 (.1) Lus10010081 [exp] 133 / 5e-40 AT2G46990 115 / 4e-33 indole-3-acetic acid inducible 20 (.1) Lus10039488 [exp] 97 / 3e-25 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 97 / 3e-25 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10014464 [exp] 98 / 9e-25 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10023719 [exp] 97 / 2e-24 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10028222 [exp] 97 / 2e-24 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10042929 [exp] 97 / 6e-24 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.014G111700.1 pacid=42763007 polypeptide=Potri.014G111700.1.p locus=Potri.014G111700 ID=Potri.014G111700.1.v4.1 annot-version=v4.1 ATGGGCAGAGGAGCTACCTCTAGTTCTTCATCTTCTTTTGAAAGCAGCAACTACCCATCTGTATCAAGCAAGTCTTCTCTCTCTCAGCTAAAGAAAGACC TAAGCACAGATCTCAGGCTTGGACTTAGCATCTCAACCTCTCAACAGGAGAACCCTTCTACACCAAGTGATCAGCAACTTTCGGACTGGCCACCAATCAA GCCATTTCTAAGGAAGGCATTAGTGTCAGAAGAAAATGAGTGCAGTAGTGCCACCTTCTTCGTCAAGGTTTACATGGAAGGCATTCCGATTGGAAGGAAG CTCAACCTCTTAGCCCATGATGGTTACCATGACTTAATACAGACTCTTGACCAAATGTTCAACACTAGCATTCTCTGGCCTGAAATGGATATTGAACATT CTGGGCAATGTCATGTGTTGACATATGAAGACAAAGAGGGGGATTGGTTGATTGTTGGGGATGTTCCCTGGGAGATGTTCTTACCTTCTGTGCGGAGATT GAAGATCACTAGGGCAGACAGCCTATGA
AA sequence Show only first row Show all	>Potri.014G111700.1 pacid=42763007 polypeptide=Potri.014G111700.1.p locus=Potri.014G111700 ID=Potri.014G111700.1.v4.1 annot-version=v4.1 MGRGATSSSSSSFESSNYPSVSSKSSLSQLKKDLSTDLRLGLSISTSQQENPSTPSDQQLSDWPPIKPFLRKALVSEENECSSATFFVKVYMEGIPIGRK LNLLAHDGYHDLIQTLDQMFNTSILWPEMDIEHSGQCHVLTYEDKEGDWLIVGDVPWEMFLPSVRRLKITRADSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G62100	AUX_IAA	IAA30	indole-3-acetic acid inducible...		Potri.014G111700 [exp]	0	1	Pt-IAA4.2
AT1G79915			Putative methyltransferase fam...		Potri.001G181200 [exp]	12.20	0.7691
AT3G61250	MYB	LMI2, ATMYB17	LATE MERISTEM IDENTITY2, myb d...		Potri.012G140700 [exp]	14.59	0.7562
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Potri.016G138600 [exp]	15.68	0.7263
AT3G15160			unknown protein		Potri.011G135800 [exp]	18.30	0.7331
					Potri.009G042350 [exp]	18.76	0.6753
					Potri.003G217500 [exp]	22.18	0.7684
AT4G38800		ATMTN1, ATMTAN1	ARABIDOPSIS METHYLTHIOADENOSIN...		Potri.004G167200 [exp]	22.22	0.6941
AT1G20850		XCP2	xylem cysteine peptidase 2 (.1...		Potri.002G005700 [exp]	23.49	0.7154
AT4G35300		TMT2	tonoplast monosaccharide trans...		Potri.005G098900 [exp]	24.24	0.7024
AT5G50570	SBP	SPL13, SPL13A	SQUAMOSA PROMOTER-BINDING PROT...		Potri.012G100700 [exp]	26.40	0.6971

Compare expression of checked genes

Potri.014G111700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.