Potri.014G114500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G66870 96 / 1e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G43670 96 / 1e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G34480 102 / 2e-26 O-Glycosyl hydrolases family 17 protein (.1)
AT1G66852 89 / 7e-24 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G24318 95 / 9e-24 O-Glycosyl hydrolases family 17 protein (.1.2)
AT5G63225 88 / 1e-23 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G09090 87 / 4e-23 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G29360 92 / 9e-23 O-Glycosyl hydrolases family 17 protein (.1.2)
AT2G16230 91 / 2e-22 O-Glycosyl hydrolases family 17 protein (.1)
AT5G67460 91 / 2e-22 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G115400 105 / 1e-27 AT4G34480 645 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.004G153800 103 / 6e-27 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.001G240000 103 / 1e-26 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.001G380600 95 / 4e-26 AT1G78520 145 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.001G351600 95 / 5e-26 AT1G78520 119 / 9e-36 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G099000 92 / 2e-25 AT1G78520 133 / 4e-42 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.002G261800 98 / 9e-25 AT2G16230 635 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.002G224600 91 / 3e-22 AT2G05790 750 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.011G099600 85 / 5e-22 AT1G78520 127 / 6e-39 Carbohydrate-binding X8 domain superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032719 99 / 2e-25 AT2G16230 430 / 4e-149 O-Glycosyl hydrolases family 17 protein (.1)
Lus10040461 99 / 3e-25 AT2G16230 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10012080 99 / 4e-25 AT2G16230 564 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10023576 99 / 4e-25 AT2G16230 644 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10040808 93 / 6e-23 AT5G24318 484 / 2e-168 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10042492 87 / 7e-23 AT1G78520 127 / 3e-39 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10016539 92 / 1e-22 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10004962 90 / 6e-22 AT5G24318 462 / 8e-161 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10040294 89 / 1e-21 AT3G55430 483 / 2e-169 O-Glycosyl hydrolases family 17 protein (.1)
Lus10005459 88 / 1e-21 AT5G24318 341 / 3e-115 O-Glycosyl hydrolases family 17 protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Potri.014G114500.1 pacid=42762588 polypeptide=Potri.014G114500.1.p locus=Potri.014G114500 ID=Potri.014G114500.1.v4.1 annot-version=v4.1
ATGGTTATTGCGAAGTATCCCTCGGTCTGCCTTCCTCTGGCCTTTGCTTTACTTCTTTGTCTTGCTGTTTCTACAGAGTCACAATCCTATGGCCATGGAG
GAAACCAGGACCAGATCAGGGCAGATGATGTTCAGAGCAGGTGGTGCATTGCTAAACCATCGGCATATAATTTTGAGCTTTTGCGCAACATAGATTATAG
CTGTGGGCAAAATGGAGTGGACTGCGGGCAAATTCAACCAGGTGGTGGCTGCTTTCGTCCAGACACTGCCTTTGGACATGCCTCCTACGCTATGAATCTC
TTCTTCAAGGCTGCAGGAAAGCACCCATGGGATTGCCATTTCAATGGTACTGGCATTGTTGTTACTCAGGACCCATCCTTTGGTACCTGCACCTATCCCC
TGTAA
AA sequence
>Potri.014G114500.1 pacid=42762588 polypeptide=Potri.014G114500.1.p locus=Potri.014G114500 ID=Potri.014G114500.1.v4.1 annot-version=v4.1
MVIAKYPSVCLPLAFALLLCLAVSTESQSYGHGGNQDQIRADDVQSRWCIAKPSAYNFELLRNIDYSCGQNGVDCGQIQPGGGCFRPDTAFGHASYAMNL
FFKAAGKHPWDCHFNGTGIVVTQDPSFGTCTYPL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G66870 Carbohydrate-binding X8 domain... Potri.014G114500 0 1
AT4G25150 HAD superfamily, subfamily III... Potri.001G191000 4.12 0.9656
Potri.001G387900 6.32 0.9629
AT4G13440 Calcium-binding EF-hand family... Potri.019G029100 8.00 0.9367
Potri.006G258250 13.03 0.9334
AT5G62420 NAD(P)-linked oxidoreductase s... Potri.001G125400 14.38 0.8837
AT3G48770 DNA binding;ATP binding (.1) Potri.015G102301 18.89 0.9538
AT1G20190 ATHEXPALPHA1.14... EXPANSIN 11, expansin 11 (.1) Potri.005G244100 19.02 0.8996 Pt-ATEXPA11.1,PtrEXPA18
Potri.001G388100 20.92 0.9176
Potri.015G120700 24.24 0.9533
AT1G07300 josephin protein-related (.1) Potri.001G249500 26.98 0.8995

Potri.014G114500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.