Potri.014G116166 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.014G116166.1 pacid=42762912 polypeptide=Potri.014G116166.1.p locus=Potri.014G116166 ID=Potri.014G116166.1.v4.1 annot-version=v4.1
ATGATGAAATCTTTCGGCGATGCAGCAGCAACGGTTAACAATCAAGACAATCTTATGCAGCAGCAGCAGTCGGTGCAGGTTAAGGATGACGATCATTTTA
GTATCCGTGAAGTGCAATTGGATAAGAACAAGAAACGCAAGTTCAATGATGATGATATGAAAAAAACACTTTGA
AA sequence
>Potri.014G116166.1 pacid=42762912 polypeptide=Potri.014G116166.1.p locus=Potri.014G116166 ID=Potri.014G116166.1.v4.1 annot-version=v4.1
MMKSFGDAAATVNNQDNLMQQQQSVQVKDDDHFSIREVQLDKNKKRKFNDDDMKKTL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.014G116166 0 1
AT5G65840 Thioredoxin superfamily protei... Potri.007G007201 3.87 0.9175
Potri.015G072732 5.00 0.9002
Potri.001G420750 8.36 0.8361
AT4G24280 CPHSC70-1 chloroplast heat shock protein... Potri.019G077850 8.71 0.7275
AT3G26020 Protein phosphatase 2A regulat... Potri.004G177900 9.38 0.8328
AT1G75220 AtERDL6 ERD6-like 6, Major facilitator... Potri.005G122550 9.94 0.8372
AT5G49460 ACLB-2 ATP citrate lyase subunit B 2 ... Potri.010G145766 10.58 0.8378
AT3G59140 ATMRP14, ABCC10 ATP-binding cassette C10, mult... Potri.003G135701 11.22 0.7950
AT3G27810 MYB AtMYB3, ATMYB21 ARABIDOPSIS THALIANA MYB DOMA... Potri.001G346600 12.24 0.7769 Pt-MYB24.2,MYB207
Potri.002G022002 12.72 0.7649

Potri.014G116166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.