GOLS2.1 (Potri.014G116800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol GOLS2.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G47180 568 / 0 ATGOLS1 galactinol synthase 1 (.1)
AT1G56600 539 / 0 ATGOLS2 galactinol synthase 2 (.1)
AT1G09350 514 / 0 ATGOLS3 galactinol synthase 3 (.1)
AT1G60470 508 / 0 ATGOLS4 galactinol synthase 4 (.1)
AT4G26250 470 / 8e-168 ATGOLS6 galactinol synthase 6 (.1)
AT5G23790 455 / 5e-162 ATGOLS5 galactinol synthase 5 (.1)
AT1G60450 452 / 8e-161 ATGOLS7 galactinol synthase 7 (.1)
AT5G30500 434 / 1e-153 GolS10 galactinol synthase 10, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
AT3G18660 83 / 3e-17 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
AT1G77130 79 / 4e-16 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G191600 648 / 0 AT2G47180 565 / 0.0 galactinol synthase 1 (.1)
Potri.005G006800 544 / 0 AT1G56600 539 / 0.0 galactinol synthase 2 (.1)
Potri.013G005800 538 / 0 AT1G56600 543 / 0.0 galactinol synthase 2 (.1)
Potri.010G150400 526 / 0 AT2G47180 519 / 0.0 galactinol synthase 1 (.1)
Potri.008G101000 511 / 0 AT2G47180 507 / 0.0 galactinol synthase 1 (.1)
Potri.010G042000 501 / 4e-180 AT1G60470 534 / 0.0 galactinol synthase 4 (.1)
Potri.008G189400 497 / 2e-178 AT1G60470 545 / 0.0 galactinol synthase 4 (.1)
Potri.013G005900 366 / 4e-128 AT1G56600 363 / 2e-127 galactinol synthase 2 (.1)
Potri.007G107200 82 / 8e-17 AT3G18660 884 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031434 543 / 0 AT2G47180 543 / 0.0 galactinol synthase 1 (.1)
Lus10010897 528 / 0 AT2G47180 533 / 0.0 galactinol synthase 1 (.1)
Lus10029145 499 / 5e-179 AT2G47180 493 / 1e-176 galactinol synthase 1 (.1)
Lus10013020 343 / 2e-117 AT2G47180 336 / 3e-114 galactinol synthase 1 (.1)
Lus10018922 87 / 2e-18 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10028623 86 / 2e-18 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10033485 79 / 6e-16 AT3G18660 677 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10020890 76 / 5e-15 AT3G18660 828 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10021731 75 / 1e-14 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Lus10042658 75 / 2e-14 AT4G33330 801 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0110 GT-A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Representative CDS sequence
>Potri.014G116800.1 pacid=42763759 polypeptide=Potri.014G116800.1.p locus=Potri.014G116800 ID=Potri.014G116800.1.v4.1 annot-version=v4.1
ATGGCTCCTGAGCTTGTCCAGGCTGCTTTGAAACCAGCTGGGTTCACCAAACCTGCTAGCTTACCTAGCCGGGCTTATGTAACATTCTTGGCTGGTAATG
GAGATTACGTCAAAGGTGTTGTTGGGTTAGCCAAAGGATTAAGGAAAGTCAAAACGGCATACCCATTAATCGTTGCAGTTTTGCCTGACGTGCCAGAGGA
ACACAGGCGGATTTTAGAGTCGCAGGGTTGCATAGTCCGGGAAATTGAACCCGTTTATCCACCAGAGAATCAGACCCAGTTTGCCATGGCTTATTATGTC
ATCAACTACTCCAAGCTCCGTATTTGGGAGTTTGTGGAATACAGCAAGATGATATACTTGGATGGAGATATCCAGGTTTATGACAACATAGACCACTTAT
TTGATCTGCCTGATGGTCATTTCTATGCGGTGATGGATTGTTTCTGTGAGAAAACATGGAGCCACACTCCACAGTACAAGATTGGCTATTGCCAGCAATG
CCCTGACAAGGTTAACTGGCCTGCTGAGATGGGTCAACCACCATCTCTTTACTTCAATGCTGGTATGTTTGTATTTGAACCTAGTATCTCGACCTATCAT
GACCTCTTGAAGACTCTCAAGGTCACTCCGCCTACGCCATTCGCAGAGCAGGACTTCTTGAACATGTACTTCAAGGATATTTACAAGCCAATTCCTCTAG
TATACAATCTTGTTCTTGCCATGTTATGGCGTCACCCAGACAACGTGGAGCTAGACAAGGTCAAAGTTGTTCACTACTGTGCAGCGGGCTCAAAGCCATG
GAGATACACTGGCAAAGAAGAGAACATGCAAAGGGAGGACATAAAGATGCTGGTGGAGAAATGGTGGGGCATTTACAATGATGAATCGCTGGATTACATG
AAATTTGTGGCGGATGGTATTGATGCTGAGCCAGTGAACTTGCAGTCTTTCATTGCAGCTCTCTATGAAGCCGGTGCTGTTCAGTACGTCACTGCCCCAT
CCGCTGCTTAG
AA sequence
>Potri.014G116800.1 pacid=42763759 polypeptide=Potri.014G116800.1.p locus=Potri.014G116800 ID=Potri.014G116800.1.v4.1 annot-version=v4.1
MAPELVQAALKPAGFTKPASLPSRAYVTFLAGNGDYVKGVVGLAKGLRKVKTAYPLIVAVLPDVPEEHRRILESQGCIVREIEPVYPPENQTQFAMAYYV
INYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGHFYAVMDCFCEKTWSHTPQYKIGYCQQCPDKVNWPAEMGQPPSLYFNAGMFVFEPSISTYH
DLLKTLKVTPPTPFAEQDFLNMYFKDIYKPIPLVYNLVLAMLWRHPDNVELDKVKVVHYCAAGSKPWRYTGKEENMQREDIKMLVEKWWGIYNDESLDYM
KFVADGIDAEPVNLQSFIAALYEAGAVQYVTAPSAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G47180 ATGOLS1 galactinol synthase 1 (.1) Potri.014G116800 0 1 GOLS2.1
AT5G20150 ATSPX1 ARABIDOPSIS THALIANA SPX DOMA... Potri.006G069500 1.41 0.8745
AT3G03750 SUVR3, SDG20 SET domain protein 20 (.1.2) Potri.013G064600 6.70 0.8385 SDG935
AT2G15560 Putative endonuclease or glyco... Potri.009G100600 8.77 0.8840
AT1G66080 unknown protein Potri.004G082100 16.06 0.8701
AT3G28970 AAR3 antiauxin-resistant 3, Domain ... Potri.004G122100 20.00 0.7969
AT5G54940 Translation initiation factor ... Potri.010G151700 21.67 0.7192
AT5G52880 F-box family protein (.1) Potri.012G035500 22.18 0.7568
AT5G35320 unknown protein Potri.018G132600 23.49 0.8483
AT4G12040 AtSAP7 stress-associated protein 7, A... Potri.001G115000 23.87 0.7595
AT4G24280 CPHSC70-1 chloroplast heat shock protein... Potri.004G224400 29.00 0.8143 Pt-HSC70.1

Potri.014G116800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.