Potri.014G123500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61710 42 / 6e-05 unknown protein
AT4G02160 41 / 0.0001 unknown protein
AT5G38700 39 / 0.0008 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G199100 178 / 7e-57 AT4G02160 50 / 9e-08 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025039 68 / 2e-14 AT5G61710 51 / 2e-08 unknown protein
Lus10010018 59 / 3e-11 AT4G02160 43 / 7e-06 unknown protein
Lus10010019 40 / 0.0006 AT5G38700 164 / 8e-52 unknown protein
Lus10025041 39 / 0.0007 AT5G38700 150 / 2e-46 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05553 DUF761 Cotton fibre expressed protein
Representative CDS sequence
>Potri.014G123500.1 pacid=42763094 polypeptide=Potri.014G123500.1.p locus=Potri.014G123500 ID=Potri.014G123500.1.v4.1 annot-version=v4.1
ATGGAACATCGATCAGGTGCTGTCATTGATATTTTCAGTACAGTTACCGACAACGGAGGCCATCGAGATGGCGTCGACCCAAAGCCGACGAAGAAAAAGC
GGAGTCCAATGCACATCCTTAGGGTGGCAAATTATATGCTCTCTCTAAAATCTGGCAAATCAAAAACTGCCCACACCGATGCTGTCTCAAAGTGGAAGAA
ACTCTTGTCTTCCATGCGCCCTTTGCACATTAACAGCAACCAATCAGCCCAACGTAGCATTGGGGACAGGGCACCGATGGCACCTTTAACATCCAAGGAG
GTTGTTGAACAATCAAAGGTTTATGCACCTTCCGCGGCATCCGAGGATGTTGAACAATTTGAGCTTTTTACCCCACCTTGGTCACCGGCCCCAAAAAGCA
CAGGATCATCGTCTGGTCAAACTAGCCAATACGCATCGGCCCAAAATCTTCAAGAGCTTGATGATCAGAGCGATGAAGATGATGAGGATAGTTATTATGA
TGATAAATTCGGGGACGAAAAGATAGACATGAAGGCTGAGGAGTTCATTGCTAAATTTTATGGCCAAATGAAGCTTCAACATAAGATTTGA
AA sequence
>Potri.014G123500.1 pacid=42763094 polypeptide=Potri.014G123500.1.p locus=Potri.014G123500 ID=Potri.014G123500.1.v4.1 annot-version=v4.1
MEHRSGAVIDIFSTVTDNGGHRDGVDPKPTKKKRSPMHILRVANYMLSLKSGKSKTAHTDAVSKWKKLLSSMRPLHINSNQSAQRSIGDRAPMAPLTSKE
VVEQSKVYAPSAASEDVEQFELFTPPWSPAPKSTGSSSGQTSQYASAQNLQELDDQSDEDDEDSYYDDKFGDEKIDMKAEEFIAKFYGQMKLQHKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G61710 unknown protein Potri.014G123500 0 1
AT4G13830 J20 DNAJ-like 20 (.1.2) Potri.005G078801 1.41 0.9780
AT4G21410 CRK29 cysteine-rich RLK (RECEPTOR-li... Potri.011G028800 5.00 0.9712
AT4G26200 ACS7, ATACS7 1-amino-cyclopropane-1-carboxy... Potri.006G149600 7.14 0.9793 ACS6,ACS3.1
AT1G77120 ADH1, ATADH, AT... ARABIDOPSIS THALIANA ALCOHOL D... Potri.005G060300 7.74 0.9677
AT1G11330 S-locus lectin protein kinase ... Potri.011G038401 9.74 0.9665
AT1G11050 Protein kinase superfamily pro... Potri.005G181800 11.74 0.9744
AT1G77120 ADH1, ATADH, AT... ARABIDOPSIS THALIANA ALCOHOL D... Potri.005G060200 13.56 0.9662
AT2G26730 Leucine-rich repeat protein ki... Potri.012G078100 18.08 0.9537
AT2G40070 unknown protein Potri.010G177000 21.56 0.9571
Potri.003G071050 22.80 0.9696

Potri.014G123500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.