Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49300 106 / 2e-30 GATA GATA16 GATA transcription factor 16 (.1) AT3G06740 91 / 2e-24 GATA GATA15 GATA transcription factor 15 (.1) AT3G16870 81 / 9e-20 GATA GATA17 GATA transcription factor 17 (.1) AT4G16141 71 / 4e-16 GATA GATA type zinc finger transcription factor family protein (.1) AT5G56860 67 / 5e-14 GATA GATA21, GNC GATA, nitrate-inducible, carbon metabolism-involved, GATA TRANSCRIPTION FACTOR 21, GATA type zinc finger transcription factor family protein (.1) AT5G26930 64 / 5e-14 GATA GATA23 GATA transcription factor 23 (.1) AT2G18380 64 / 3e-13 GATA GATA20, HANL1 hanaba taranu like 1, GATA transcription factor 20 (.1) AT1G08010 63 / 2e-12 GATA GATA11 GATA transcription factor 11 (.1.2) AT4G36620 62 / 2e-12 GATA GATA19, HANL2 hanaba taranu like 2, GATA transcription factor 19 (.1) AT4G26150 62 / 3e-12 GATA GATA22, CGA1, GNL GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G199800 [exp] 202 / 2e-68 AT5G49300 112 / 1e-32 GATA transcription factor 16 (.1) Potri.010G001300 [exp] 100 / 1e-27 AT3G06740 135 / 2e-41 GATA transcription factor 15 (.1) Potri.008G213900 [exp] 99 / 2e-27 AT3G06740 126 / 4e-38 GATA transcription factor 15 (.1) Potri.005G020500 [exp] 87 / 1e-22 AT3G06740 67 / 1e-14 GATA transcription factor 15 (.1) Potri.006G229200 [exp] 67 / 5e-14 AT4G26150 111 / 3e-28 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.010G223300 [exp] 63 / 2e-12 AT3G54810 148 / 8e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.008G038900 [exp] 63 / 2e-12 AT3G54810 150 / 1e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.004G211800 [exp] 60 / 2e-11 AT1G08010 150 / 4e-43 GATA transcription factor 11 (.1.2) Potri.007G024500 [exp] 60 / 2e-11 AT3G50870 202 / 5e-64 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016849 [exp] 96 / 3e-26 AT3G06740 154 / 6e-49 GATA transcription factor 15 (.1) Lus10037721 [exp] 95 / 1e-25 AT3G06740 153 / 2e-48 GATA transcription factor 15 (.1) Lus10036329 [exp] 79 / 4e-18 AT1G02700 189 / 1e-57 unknown protein Lus10010027 [exp] 71 / 2e-16 AT5G49300 87 / 8e-23 GATA transcription factor 16 (.1) Lus10029863 [exp] 71 / 1e-15 AT4G16141 90 / 1e-22 GATA type zinc finger transcription factor family protein (.1) Lus10020684 [exp] 70 / 1e-15 AT4G16141 94 / 9e-24 GATA type zinc finger transcription factor family protein (.1) Lus10031464 [exp] 61 / 2e-12 AT3G24050 69 / 3e-15 GATA transcription factor 1 (.1) Lus10011430 [exp] 62 / 6e-12 AT4G32890 237 / 9e-77 GATA transcription factor 9 (.1) Lus10028301 [exp] 60 / 1e-11 AT3G50870 135 / 4e-39 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Lus10009227 [exp] 59 / 4e-11 AT3G54810 162 / 8e-47 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF00320 [poplar] [flax] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Potri.014G124400.1 pacid=42763430 polypeptide=Potri.014G124400.1.p locus=Potri.014G124400 ID=Potri.014G124400.1.v4.1 annot-version=v4.1 ATGGATTTCAACACAAAAGGATCAGAGTCAGAGGACATGGATAGTACTCAATCAAGCAAGGGTAACGAGATCAAAAGAAGATGCATGGATTGCCAAACTA CAAGAACCCCATGTTGGCGAGGCGGTCCGGCTGGTCCCAGGACACTGTGCAATGCATGTGGGATCAGACAGAGGAAGAAGAGGAGAGCACTTCATGGGTC GGACAAAGGAGGAGCGGAGAGGAGTAAAAATAAGATTGCTAAAAGTAGCAATAGTAGTAAGCTAGGAGTTTCATTGAAGCTAGATTTGATGGGTTTTAGA AGAGATGGGATATTGCAGGAAGATTGGAAGAGAAAACTGGGAGAGGAAGAACAGGCTGCCATACTCTTGATGGCCTTATCTTGTGGCTTGGTCCGTGCTT AG
AA sequence Show only first row Show all	>Potri.014G124400.1 pacid=42763430 polypeptide=Potri.014G124400.1.p locus=Potri.014G124400 ID=Potri.014G124400.1.v4.1 annot-version=v4.1 MDFNTKGSESEDMDSTQSSKGNEIKRRCMDCQTTRTPCWRGGPAGPRTLCNACGIRQRKKRRALHGSDKGGAERSKNKIAKSSNSSKLGVSLKLDLMGFR RDGILQEDWKRKLGEEEQAAILLMALSCGLVRA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G49300	GATA	GATA16	GATA transcription factor 16 (...		Potri.014G124400 [exp]	0	1
AT5G53490			Tetratricopeptide repeat (TPR)...		Potri.012G018100 [exp]	1.41	0.8756
AT5G24490			30S ribosomal protein, putativ...		Potri.015G002200 [exp]	14.66	0.8378
AT1G09575			Protein of unknown function (D...		Potri.013G161300 [exp]	28.74	0.7683
AT4G15110		CYP97B3	"cytochrome P450, family 97, s...		Potri.006G006200 [exp]	52.00	0.7939
AT4G16745			Exostosin family protein (.1.2...		Potri.003G079000 [exp]	53.15	0.7692
AT4G26810			SWIB/MDM2 domain superfamily p...		Potri.015G137600 [exp]	74.49	0.7531
AT3G17970		ATTOC64-III	translocon at the outer membra...		Potri.015G038600 [exp]	97.26	0.7695	AMI3,TOC64.2
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Potri.002G120600 [exp]	104.90	0.7610
AT1G79790		AtcpFHy1	flavin mononucleotide hydrolas...		Potri.010G143000 [exp]	140.17	0.7483
AT3G09150		ATHY2, GUN3, HY...	GENOMES UNCOUPLED 3, ARABIDOPS...		Potri.001G253700 [exp]	140.19	0.7769

Compare expression of checked genes

Potri.014G124400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.