Pt-ARR5.2 (Potri.014G125400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-ARR5.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16110 54 / 5e-09 GARP ARR2 response regulator 2 (.1)
AT3G16857 54 / 7e-09 GARP ARR1 response regulator 1 (.1.2)
AT2G25180 52 / 3e-08 GARP ARR12 response regulator 12 (.1)
AT4G31920 50 / 1e-07 GARP ARR10 response regulator 10 (.1)
AT1G67710 50 / 2e-07 GARP ARR11 response regulator 11 (.1)
AT2G01760 49 / 3e-07 GARP ARR14 response regulator 14 (.1)
AT5G58080 45 / 8e-06 GARP ARR18 response regulator 18 (.1)
AT1G49190 44 / 1e-05 GARP ARR19 response regulator 19 (.1.2)
AT3G62670 42 / 8e-05 GARP ARR20, MEE41 maternal effect embryo arrest 41, response regulator 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G001000 56 / 1e-09 AT4G16110 602 / 0.0 response regulator 2 (.1)
Potri.008G213500 55 / 3e-09 AT4G16110 602 / 0.0 response regulator 2 (.1)
Potri.008G135500 53 / 1e-08 AT4G16110 370 / 3e-119 response regulator 2 (.1)
Potri.006G188000 52 / 3e-08 AT2G25180 386 / 8e-126 response regulator 12 (.1)
Potri.008G181000 52 / 4e-08 AT1G67710 383 / 5e-127 response regulator 11 (.1)
Potri.010G105600 51 / 7e-08 AT4G16110 376 / 2e-121 response regulator 2 (.1)
Potri.006G262100 50 / 2e-07 AT2G25180 381 / 6e-124 response regulator 12 (.1)
Potri.018G021300 49 / 4e-07 AT2G25180 364 / 2e-117 response regulator 12 (.1)
Potri.010G053100 48 / 7e-07 AT1G67710 380 / 2e-126 response regulator 11 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016846 59 / 1e-10 AT3G16857 603 / 0.0 response regulator 1 (.1.2)
Lus10037719 56 / 2e-09 AT3G16857 613 / 0.0 response regulator 1 (.1.2)
Lus10025044 56 / 2e-09 AT4G31920 220 / 6e-65 response regulator 10 (.1)
Lus10036303 51 / 9e-08 AT2G25180 294 / 4e-92 response regulator 12 (.1)
Lus10005340 49 / 3e-07 AT2G25180 414 / 3e-137 response regulator 12 (.1)
Lus10041020 49 / 3e-07 AT2G25180 412 / 3e-136 response regulator 12 (.1)
Lus10011389 48 / 7e-07 AT1G67710 385 / 1e-130 response regulator 11 (.1)
Lus10006446 48 / 7e-07 AT1G67710 377 / 9e-127 response regulator 11 (.1)
Lus10019058 47 / 2e-06 AT2G25180 290 / 1e-90 response regulator 12 (.1)
Lus10008879 42 / 0.0001 AT5G24470 316 / 4e-98 pseudo-response regulator 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0304 CheY PF00072 Response_reg Response regulator receiver domain
Representative CDS sequence
>Potri.014G125400.2 pacid=42764781 polypeptide=Potri.014G125400.2.p locus=Potri.014G125400 ID=Potri.014G125400.2.v4.1 annot-version=v4.1
ATGCGCCAGATTCGTCTCTCTTTAAACATCATTCATTTCACCCCTTCACAGTCACCAAATGTGGAAGAGGAAAGGAGGTTTTGTCAATGCTTCGAGAGGA
TAAGAACAGGTTTGACGTTCTTGGAAATGATCTGCAAATGCATGAAATGGATGGAATTCAGCTCCTTAAGATCATCCGATCAGAAATGGATTTGCCTGTC
GTCAGGTGTTCTTCAGGGTGCTTGTGATTGTTTGATCAAGCCTGTTAAGATGGAAGCTCTTAAAGTCTTTTGGCAGCACGTGGTTCGCAAGAAAATTAAC
AACACTTTAGAACGATTAGAACAGCCAAGAAGAAAGGAAGAGGATAAATTGCATTTGGAGAATTCTTGTATTGTTAGCTGTACAGTCTCTGGAAATGCAG
GACATCCTATGACCTTGAAAAGGAAAATAGATGGTGAAGATGAAGGCAAGGCTTCAGATGGTTTGTCTACGGGAAAGAAATGA
AA sequence
>Potri.014G125400.2 pacid=42764781 polypeptide=Potri.014G125400.2.p locus=Potri.014G125400 ID=Potri.014G125400.2.v4.1 annot-version=v4.1
MRQIRLSLNIIHFTPSQSPNVEEERRFCQCFERIRTGLTFLEMICKCMKWMEFSSLRSSDQKWICLSSGVLQGACDCLIKPVKMEALKVFWQHVVRKKIN
NTLERLEQPRRKEEDKLHLENSCIVSCTVSGNAGHPMTLKRKIDGEDEGKASDGLSTGKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67710 GARP ARR11 response regulator 11 (.1) Potri.014G125400 0 1 Pt-ARR5.2
Potri.003G151850 21.07 0.9053
AT2G38050 DWF6, DET2, ATD... DWARF 6, DE-ETIOLATED 2, 3-oxo... Potri.005G047800 28.40 0.9025
Potri.009G050500 28.49 0.8986
AT4G27290 S-locus lectin protein kinase ... Potri.001G412700 30.00 0.8661
Potri.012G032376 64.34 0.8627
Potri.008G155600 121.20 0.8511
AT1G29740 Leucine-rich repeat transmembr... Potri.011G073641 131.40 0.8215
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Potri.017G124600 133.99 0.8217 Pt-HBGGPPS2.1
AT1G15780 unknown protein Potri.006G031200 135.29 0.8423
AT1G58190 AtRLP9 receptor like protein 9 (.1.2) Potri.005G008901 147.51 0.8518

Potri.014G125400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.