Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02340 154 / 1e-47 alpha/beta-Hydrolases superfamily protein (.1) AT4G15955 115 / 9e-34 alpha/beta-Hydrolases superfamily protein (.1.2.3) AT3G05600 116 / 1e-32 alpha/beta-Hydrolases superfamily protein (.1) AT4G15960 114 / 2e-31 alpha/beta-Hydrolases superfamily protein (.1) AT2G26740 105 / 8e-29 ATSEH soluble epoxide hydrolase (.1) AT2G26750 99 / 3e-26 alpha/beta-Hydrolases superfamily protein (.1) AT3G51000 94 / 2e-24 alpha/beta-Hydrolases superfamily protein (.1) AT1G52750 49 / 6e-08 alpha/beta-Hydrolases superfamily protein (.1) AT1G80280 45 / 2e-06 alpha/beta-Hydrolases superfamily protein (.1) AT1G15490 42 / 2e-05 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G127200 [exp] 172 / 1e-54 AT4G02340 519 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.002G202700 [exp] 172 / 2e-54 AT4G02340 513 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.005G081000 [exp] 165 / 1e-51 AT4G02340 455 / 1e-161 alpha/beta-Hydrolases superfamily protein (.1) Potri.013G013500 [exp] 134 / 5e-40 AT3G05600 425 / 2e-150 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G010700 [exp] 120 / 3e-34 AT4G15960 404 / 2e-141 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G010900 [exp] 119 / 8e-34 AT4G15960 412 / 3e-144 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G010800 [exp] 119 / 1e-33 AT4G15960 413 / 1e-144 alpha/beta-Hydrolases superfamily protein (.1) Potri.007G018900 [exp] 106 / 6e-29 AT3G51000 454 / 9e-162 alpha/beta-Hydrolases superfamily protein (.1) Potri.011G048000 [exp] 97 / 2e-25 AT3G51000 219 / 2e-69 alpha/beta-Hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026141 [exp] 152 / 9e-47 AT4G02340 446 / 6e-159 alpha/beta-Hydrolases superfamily protein (.1) Lus10026140 [exp] 141 / 7e-43 AT4G02340 329 / 2e-113 alpha/beta-Hydrolases superfamily protein (.1) Lus10004439 [exp] 140 / 5e-42 AT4G02340 384 / 3e-134 alpha/beta-Hydrolases superfamily protein (.1) Lus10008683 [exp] 137 / 7e-41 AT4G02340 428 / 1e-151 alpha/beta-Hydrolases superfamily protein (.1) Lus10010293 [exp] 135 / 5e-40 AT4G02340 476 / 1e-170 alpha/beta-Hydrolases superfamily protein (.1) Lus10037577 [exp] 134 / 1e-39 AT4G02340 384 / 6e-134 alpha/beta-Hydrolases superfamily protein (.1) Lus10026138 [exp] 128 / 2e-39 AT4G02340 185 / 7e-59 alpha/beta-Hydrolases superfamily protein (.1) Lus10006827 [exp] 127 / 4e-37 AT4G02340 380 / 8e-133 alpha/beta-Hydrolases superfamily protein (.1) Lus10037559 [exp] 126 / 1e-36 AT4G02340 367 / 2e-127 alpha/beta-Hydrolases superfamily protein (.1) Lus10029878 [exp] 124 / 6e-36 AT3G05600 425 / 3e-150 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [poplar] [flax] AB_hydrolase PF00561 [poplar] [flax] Abhydrolase_1 alpha/beta hydrolase fold
Representative CDS sequence Show only first row Show all	>Potri.014G127101.1 pacid=42762421 polypeptide=Potri.014G127101.1.p locus=Potri.014G127101 ID=Potri.014G127101.1.v4.1 annot-version=v4.1 ATGGAGAAGATCGAGCACACAACAGTTGCCACAGATCGCATAAACATGCACATAGCATCAATAGGAAGAGGCCCAGCAATCTTGTTCCTGCACGGTTTCC CTGAACTATGGTATTCGTGGCGGCACCAACTCCTCTCTCTTTCCTTCCTCGGTTGCCGTTGCATAGCTCCCGATCATCGTGGCTATGGAGACACCGATGC TCGCACATCAGTACGTGAGTACACCGGGTTCCACATAGTGGGCGACTTGATCGGACTTCTTAACTCGCTGGGGATCGATTTGGTGTTTTTGGTTGGTCAT ACGACTGGGGGGCCATGA
AA sequence Show only first row Show all	>Potri.014G127101.1 pacid=42762421 polypeptide=Potri.014G127101.1.p locus=Potri.014G127101 ID=Potri.014G127101.1.v4.1 annot-version=v4.1 MEKIEHTTVATDRINMHIASIGRGPAILFLHGFPELWYSWRHQLLSLSFLGCRCIAPDHRGYGDTDARTSVREYTGFHIVGDLIGLLNSLGIDLVFLVGH TTGGP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G02340			alpha/beta-Hydrolases superfam...		Potri.014G127101 [exp]	0	1
AT1G30760			FAD-binding Berberine family p...		Potri.011G158800 [exp]	8.83	0.8513
					Potri.003G074051 [exp]	25.80	0.8338
AT5G62700		atgcp3, TUB3	tubulin beta chain 3 (.1)		Potri.001G272700 [exp]	32.12	0.8488
AT1G05620		NSH2, URH2	nucleoside hydrolase 2, uridin...		Potri.007G144600 [exp]	37.09	0.8052
AT5G51400			PLAC8 family protein (.1)		Potri.003G108800 [exp]	37.70	0.7552
AT2G23090			Uncharacterised protein family...		Potri.014G018400 [exp]	37.94	0.8148
AT1G65430		ATARI8, ARI8	ARABIDOPSIS ARIADNE 8, ARIADNE...		Potri.001G214201 [exp]	44.00	0.8269
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.015G126301 [exp]	46.15	0.8187
AT3G27440		UKL5	uridine kinase-like 5 (.1)		Potri.017G071200 [exp]	55.82	0.8139
AT3G54880			unknown protein		Potri.010G227800 [exp]	62.60	0.8211

Compare expression of checked genes

Potri.014G127101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.