Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-U1A.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47580 347 / 6e-122 U1A spliceosomal protein U1A (.1) AT2G30260 256 / 3e-86 U2B'' U2 small nuclear ribonucleoprotein B (.1) AT1G06960 251 / 2e-84 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT4G12640 50 / 6e-07 RNA recognition motif (RRM)-containing protein (.1) AT3G21215 47 / 5e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G42240 42 / 0.0003 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT3G13700 41 / 0.0003 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT4G34110 42 / 0.0004 PABP2, PAB2, ATPAB2 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1) AT2G23350 42 / 0.0004 PABP4, PAB4 poly(A) binding protein 4 (.1) AT5G12190 39 / 0.0007 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G203600 [exp] 434 / 6e-156 AT2G47580 349 / 1e-122 spliceosomal protein U1A (.1) Potri.019G121400 [exp] 257 / 1e-86 AT2G30260 305 / 7e-106 U2 small nuclear ribonucleoprotein B (.1) Potri.013G153700 [exp] 254 / 2e-85 AT2G30260 297 / 8e-103 U2 small nuclear ribonucleoprotein B (.1) Potri.006G224900 [exp] 51 / 3e-07 AT1G21320 122 / 2e-33 nucleotide binding;nucleic acid binding (.1.2) Potri.012G107900 [exp] 51 / 3e-07 AT1G29400 288 / 2e-88 MEI2-like protein 5 (.1.2) Potri.012G107100 [exp] 50 / 6e-07 AT5G07290 750 / 0.0 MEI2-like 4 (.1) Potri.015G106000 [exp] 50 / 8e-07 AT5G61960 767 / 0.0 MEI2-like protein 1 (.1.2) Potri.007G046600 [exp] 47 / 3e-06 AT2G42240 334 / 4e-115 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.008G009400 [exp] 47 / 4e-06 AT3G21215 219 / 4e-69 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003358 [exp] 383 / 6e-136 AT2G47580 367 / 7e-130 spliceosomal protein U1A (.1) Lus10008424 [exp] 381 / 3e-135 AT2G47580 365 / 4e-129 spliceosomal protein U1A (.1) Lus10042240 [exp] 253 / 7e-85 AT2G30260 352 / 2e-124 U2 small nuclear ribonucleoprotein B (.1) Lus10026413 [exp] 251 / 4e-84 AT2G30260 350 / 1e-123 U2 small nuclear ribonucleoprotein B (.1) Lus10043204 [exp] 50 / 1e-06 AT5G61960 728 / 0.0 MEI2-like protein 1 (.1.2) Lus10032537 [exp] 50 / 1e-06 AT5G61960 664 / 0.0 MEI2-like protein 1 (.1.2) Lus10011968 [exp] 47 / 7e-06 AT1G29400 900 / 0.0 MEI2-like protein 5 (.1.2) Lus10004591 [exp] 47 / 8e-06 AT1G29400 908 / 0.0 MEI2-like protein 5 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) CL0221 [poplar] [flax] RRM PF13893 [poplar] [flax] RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.014G127800.1 pacid=42763967 polypeptide=Potri.014G127800.1.p locus=Potri.014G127800 ID=Potri.014G127800.1.v4.1 annot-version=v4.1 ATGGCATTACAAGAGAGAAAAGAAATGGGAGATAACAATAATAGTACAGGCACTGATGTCTCGCAGAACATGACTATTTACATCAACAATCTCAACGAGA AGATCAAAATCGATGAGTTGAAGACATCGCTGCACGCTGTGTTCTCGCAATTCGGGAAGATACTGGAGATATTGGCATTCAAGACATTGAAACACAAAGG GCAAGCTTGGGTTATTTTCGAGGATGTTCAGTCTGCCTCTAATGCTATACGGCAAATGCAGTCTTTCCCCTTTTATGATAAGCCCATGAGAATACAATAT GCAAAAACTAAATCAGATATCATAGCAAAAGCTGATGGTACTTTTGTTCCACGGGAAAAACGAAGGAGGCATGAGGAAAAAGGGAAAAAGAAGAAAGATC AACATGATGCTAATCAAGTGGGAGTGGGTCTGACCCCTGCTTATGGCGGCGCCTACGGGACAACACCTTCTCTATTACAAATACCCTATCCAGGTGGTGT GAAATCTATGGTTCCTGAGGCTCCAGCTCCACCAAATAACATTCTGTTTATTCAAAATCTTCCCAATGAGACTACTCCAATGATGCTGCAAATGCTCTTC CAGCAGTATCCCGGTTTTAAGGAGGTCAGGATGGTGGAAGCAAAGCCAGGCATTGCCTTTGTAGAGTATGGAGATGAGATGCAATCGACAGGCGCAATGC ATGGACTTCAGGGATTCAAGATACTTCAGCAGAATTCAATGTTAATTACCTACGCCAAGAAATAG
AA sequence Show only first row Show all	>Potri.014G127800.1 pacid=42763967 polypeptide=Potri.014G127800.1.p locus=Potri.014G127800 ID=Potri.014G127800.1.v4.1 annot-version=v4.1 MALQERKEMGDNNNSTGTDVSQNMTIYINNLNEKIKIDELKTSLHAVFSQFGKILEILAFKTLKHKGQAWVIFEDVQSASNAIRQMQSFPFYDKPMRIQY AKTKSDIIAKADGTFVPREKRRRHEEKGKKKKDQHDANQVGVGLTPAYGGAYGTTPSLLQIPYPGGVKSMVPEAPAPPNNILFIQNLPNETTPMMLQMLF QQYPGFKEVRMVEAKPGIAFVEYGDEMQSTGAMHGLQGFKILQQNSMLITYAKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G47580		U1A	spliceosomal protein U1A (.1)		Potri.014G127800 [exp]	0	1	Pt-U1A.2
AT3G07590			Small nuclear ribonucleoprotei...		Potri.002G054800 [exp]	1.41	0.8291
AT3G59650			mitochondrial ribosomal protei...		Potri.013G126200 [exp]	8.66	0.8234
AT4G39880			Ribosomal protein L23/L15e fam...		Potri.005G075500 [exp]	8.94	0.8115
AT1G17880		ATBTF3	basic transcription factor 3 (...		Potri.015G029800 [exp]	9.27	0.8291
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.009G090000 [exp]	10.39	0.8256
AT3G49910			Translation protein SH3-like f...		Potri.005G082600 [exp]	14.00	0.8241	Pt-RPL26.1
AT2G44860			Ribosomal protein L24e family ...		Potri.004G187800 [exp]	24.89	0.7846
AT3G13674			unknown protein		Potri.018G082800 [exp]	26.87	0.7892
AT3G05590		RPL18	ribosomal protein L18 (.1)		Potri.005G023500 [exp]	27.16	0.8214	Pt-RPL18.12
AT5G19350			RNA-binding (RRM/RBD/RNP motif...		Potri.009G054400 [exp]	28.63	0.7448

Compare expression of checked genes

Potri.014G127800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.