Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL22.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05560 174 / 2e-57 Ribosomal L22e protein family (.1.2.3) AT5G27770 148 / 2e-47 Ribosomal L22e protein family (.1) AT1G02830 129 / 1e-39 Ribosomal L22e protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G015300 [exp] 185 / 9e-62 AT3G05560 172 / 1e-56 Ribosomal L22e protein family (.1.2.3) Potri.002G204100 [exp] 184 / 1e-61 AT3G05560 172 / 8e-57 Ribosomal L22e protein family (.1.2.3) Potri.005G024400 [exp] 182 / 1e-60 AT3G05560 174 / 9e-58 Ribosomal L22e protein family (.1.2.3) Potri.010G012700 [exp] 175 / 8e-58 AT3G05560 170 / 8e-56 Ribosomal L22e protein family (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037498 [exp] 180 / 1e-59 AT3G05560 197 / 1e-66 Ribosomal L22e protein family (.1.2.3) Lus10006509 [exp] 178 / 5e-59 AT3G05560 196 / 3e-66 Ribosomal L22e protein family (.1.2.3) Lus10026555 [exp] 112 / 1e-33 AT3G05560 118 / 3e-36 Ribosomal L22e protein family (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01776 [poplar] [flax] Ribosomal_L22e Ribosomal L22e protein family
Representative CDS sequence Show only first row Show all	>Potri.014G128800.1 pacid=42764665 polypeptide=Potri.014G128800.1.p locus=Potri.014G128800 ID=Potri.014G128800.1.v4.1 annot-version=v4.1 ATGAGTCGGGCGGCAGCAGCAGGAGCTAAGGGAAAGAAGAAGGGAGCGTCCTTCGTCATTGATTGCGCTAAGCCGGTGGAGGATAAGATCATGGATATCG CCTCTCTCGAGAAGTTCCTCCAGGAGAGGATCAAGGTTGGTGGAAAGGCCGGTGCTCTTGGTGACTCTGTTACCGTTACTCGTGAGAAGAACAAGATCAC CGTTACCTCCGACAGCAACTTCTCTAAGCGGTATTTAAAGTACCTGACCAAAAAGTACTTGAAGAAACACAATGTGAGGGACTGGCTTCGAGTTATTTCT TCCAACAAAGACAGGAATGTTTACGAATTGCGCTACTTTAACATTGCCGAGAATGAGGGAGAGGAGGAAGACTGA
AA sequence Show only first row Show all	>Potri.014G128800.1 pacid=42764665 polypeptide=Potri.014G128800.1.p locus=Potri.014G128800 ID=Potri.014G128800.1.v4.1 annot-version=v4.1 MSRAAAAGAKGKKKGASFVIDCAKPVEDKIMDIASLEKFLQERIKVGGKAGALGDSVTVTREKNKITVTSDSNFSKRYLKYLTKKYLKKHNVRDWLRVIS SNKDRNVYELRYFNIAENEGEEED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05560			Ribosomal L22e protein family ...		Potri.014G128800 [exp]	0	1	RPL22.2
AT5G09500			Ribosomal protein S19 family p...		Potri.002G043200 [exp]	1.00	0.9678
AT4G27090			Ribosomal protein L14 (.1)		Potri.010G069900 [exp]	1.41	0.9662
AT4G15000			Ribosomal L27e protein family ...		Potri.016G019000 [exp]	3.16	0.9559	RPL27.1
AT4G10450			Ribosomal protein L6 family (....		Potri.011G147700 [exp]	3.46	0.9630	Pt-RPL9.4
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Potri.002G140400 [exp]	4.00	0.9571	Pt-RPS11.5
AT5G04800			Ribosomal S17 family protein (...		Potri.008G017300 [exp]	5.91	0.9546
AT2G19730			Ribosomal L28e protein family ...		Potri.001G194000 [exp]	6.92	0.9553
AT5G59850			Ribosomal protein S8 family pr...		Potri.001G118100 [exp]	7.74	0.9498	Pt-WRP15.2
AT5G27700			Ribosomal protein S21e (.1)		Potri.013G017600 [exp]	9.16	0.9485
AT3G53740			Ribosomal protein L36e family ...		Potri.012G142600 [exp]	9.48	0.9482

Compare expression of checked genes

Potri.014G128800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.