Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62820 162 / 6e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G47670 140 / 8e-42 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 99 / 1e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62360 93 / 2e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 92 / 4e-23 PME1 pectin methylesterase inhibitor 1 (.1) AT4G25260 92 / 4e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 91 / 9e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 91 / 1e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 91 / 2e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 90 / 3e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G137800 [exp] 117 / 3e-33 AT5G20740 205 / 2e-67 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128400 [exp] 113 / 1e-31 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G109300 [exp] 105 / 3e-28 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G132600 [exp] 105 / 4e-28 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 99 / 9e-26 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 97 / 2e-25 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 97 / 3e-25 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 96 / 1e-24 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 95 / 2e-24 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007873 [exp] 162 / 2e-50 AT3G62820 166 / 4e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10030370 [exp] 115 / 4e-30 AT4G02425 142 / 2e-43 unknown protein Lus10031133 [exp] 100 / 2e-26 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 100 / 3e-26 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 97 / 5e-25 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038645 [exp] 91 / 2e-22 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 89 / 4e-22 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031132 [exp] 88 / 8e-22 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 87 / 2e-21 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 87 / 3e-21 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.014G129400.1 pacid=42763280 polypeptide=Potri.014G129400.1.p locus=Potri.014G129400 ID=Potri.014G129400.1.v4.1 annot-version=v4.1 ATGAGAACTATCTCCATTCTCATCACTTTCCTTTTCCTTTCATGGCTAACATGTGCTACGAGCCGGGGTTCTGACAACGGGGACACTTATGTTCGAGAAG CATGCAGTGTGACTAGATATCATGACCTTTGCATGCACTCACTAGCATCCTTTTCGCACACTGCTGGGAGAAGTCCCAGCAAGTGGGCACGAGCTGGGGT TTCGGTGACAATAGGCGAGGCTAAGAATGCTAGTCAGTATCTGAATAAATTGAAGAAAGATAGAATCATGAGAGGCAGAAACAGGATTGCCCTTTCAGAT TGTATCGAGTGCTTCCAAGACGCGATTGACAATCTTCACAAATCACTTGGCATACTCAGAAAGCTTGACGCAACAAACTTCGATACACAGATGGGGGACC TAACTACATGGCTGAGTGCTGCACTCACAGATGAAGACACTTGCTTGGATGGTTTTGAAGATCGAAGCAGCAAACAAGTTAAAATGCTTCTGAATCAGGT TTCAAGAGTCACTTATATCACCAGTAATGCACTGGCTCTTGTTAACAAACTTGCAGCCGCTGGCTTGGGAAGCCTAAATGGTCCGTAG
AA sequence Show only first row Show all	>Potri.014G129400.1 pacid=42763280 polypeptide=Potri.014G129400.1.p locus=Potri.014G129400 ID=Potri.014G129400.1.v4.1 annot-version=v4.1 MRTISILITFLFLSWLTCATSRGSDNGDTYVREACSVTRYHDLCMHSLASFSHTAGRSPSKWARAGVSVTIGEAKNASQYLNKLKKDRIMRGRNRIALSD CIECFQDAIDNLHKSLGILRKLDATNFDTQMGDLTTWLSAALTDEDTCLDGFEDRSSKQVKMLLNQVSRVTYITSNALALVNKLAAAGLGSLNGP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G62820			Plant invertase/pectin methyle...		Potri.014G129400 [exp]	0	1
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Potri.014G152600 [exp]	1.73	0.9802
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Potri.014G152301 [exp]	2.44	0.9772
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Potri.001G251100 [exp]	5.47	0.9577
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Potri.008G165400 [exp]	6.32	0.9636
					Potri.009G008300 [exp]	7.74	0.9734
					Potri.001G001000 [exp]	8.12	0.9652
AT5G57800		CER3, FLP1, YRE...	FACELESS POLLEN 1, ECERIFERUM ...		Potri.006G177500 [exp]	9.48	0.9635
AT1G64300			Protein kinase family protein ...		Potri.014G095200 [exp]	10.67	0.9551
AT3G15570			Phototropic-responsive NPH3 fa...		Potri.003G058800 [exp]	10.90	0.9647
AT2G26580	YABBY	YAB5	YABBY5, plant-specific transcr...		Potri.006G067800 [exp]	12.40	0.9588

Compare expression of checked genes

Potri.014G129400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.