Potri.014G129600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G47690 153 / 4e-50 NADH-ubiquinone oxidoreductase-related (.1.2)
AT3G62790 151 / 9e-50 NADH-ubiquinone oxidoreductase-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G204800 157 / 5e-52 AT3G62790 144 / 5e-47 NADH-ubiquinone oxidoreductase-related (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021691 142 / 5e-46 AT3G62790 143 / 2e-46 NADH-ubiquinone oxidoreductase-related (.1)
Lus10035034 142 / 5e-46 AT3G62790 143 / 2e-46 NADH-ubiquinone oxidoreductase-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0351 CHCH PF10200 Ndufs5 NADH:ubiquinone oxidoreductase, NDUFS5-15kDa
Representative CDS sequence
>Potri.014G129600.11 pacid=42762920 polypeptide=Potri.014G129600.11.p locus=Potri.014G129600 ID=Potri.014G129600.11.v4.1 annot-version=v4.1
ATGGCATCCGGGTGGGGAATCACAGGAAACAAAGGCAGGTGCTACGATTTTTGGATGGATTTCAGCGAGTGCATGTCTCAATGCAGAGAACCCAAGGACT
GCGCTTTCCTCCGTGAAGATTACCTCGAGTGCCTCCACCACTCCAAAGAGTTCCAACGAAGAAATCGAATTTACAAGGAGGAACAGCGCAAACTAAGAGC
TGCTTCTCAGAAAGCGGACGGAGGAGATGGCAAAGATAACCATCATTGA
AA sequence
>Potri.014G129600.11 pacid=42762920 polypeptide=Potri.014G129600.11.p locus=Potri.014G129600 ID=Potri.014G129600.11.v4.1 annot-version=v4.1
MASGWGITGNKGRCYDFWMDFSECMSQCREPKDCAFLREDYLECLHHSKEFQRRNRIYKEEQRKLRAASQKADGGDGKDNHH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G47690 NADH-ubiquinone oxidoreductase... Potri.014G129600 0 1
AT2G46540 unknown protein Potri.002G173101 2.82 0.8965
AT5G53650 unknown protein Potri.012G022900 5.00 0.8693
AT1G51650 ATP synthase epsilon chain, mi... Potri.008G008900 5.83 0.8892
AT1G72020 unknown protein Potri.013G110600 6.70 0.8777
AT1G01170 Protein of unknown function (D... Potri.016G055200 9.16 0.8653
AT1G04630 MEE4 maternal effect embryo arrest ... Potri.001G054500 11.22 0.8085
AT2G33040 ATP3 gamma subunit of Mt ATP syntha... Potri.015G057700 12.00 0.8766 Pt-ATPC.2
AT5G15320 unknown protein Potri.005G236500 15.19 0.8576
AT3G22110 PAC1 20S proteasome alpha subunit C... Potri.006G008800 17.74 0.8337 Pt-PAC1.1
AT5G25570 unknown protein Potri.012G125000 19.39 0.8047

Potri.014G129600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.