Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15802 120 / 2e-37 AtHSBP Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G025000 [exp] 131 / 8e-42 AT4G15802 114 / 8e-35 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1) Potri.008G208100 [exp] 121 / 9e-38 AT4G15802 123 / 3e-38 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000501 [exp] 50 / 4e-09 AT4G15802 53 / 2e-10 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06825 [poplar] [flax] HSBP1 Heat shock factor binding protein 1
Representative CDS sequence Show only first row Show all	>Potri.014G131701.1 pacid=42764429 polypeptide=Potri.014G131701.1.p locus=Potri.014G131701 ID=Potri.014G131701.1.v4.1 annot-version=v4.1 ATGGAAGGACATGATTCCGAGGATCCCAAGCAAAGCACTGCCGACATGACTGCTTTTGTCCAACATCTTCTTCAGCAGATGCAAAGTAGGTTCCAAACAA TGTCGGACTCCATTGTTTCGAAGATTGATGAAATGGGAAACCGCATAGATGACTTGGAGAAAAGCATTGACGAGCTTAGAGAAGAAATGGGAGTTGAGGG TTCTCCATCTCCATTGGCTCCATCCAAGTTTAAGACAGAGGAAGGTTCTGCTTAG
AA sequence Show only first row Show all	>Potri.014G131701.1 pacid=42764429 polypeptide=Potri.014G131701.1.p locus=Potri.014G131701 ID=Potri.014G131701.1.v4.1 annot-version=v4.1 MEGHDSEDPKQSTADMTAFVQHLLQQMQSRFQTMSDSIVSKIDEMGNRIDDLEKSIDELREEMGVEGSPSPLAPSKFKTEEGSA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G15802		AtHSBP	Arabidopsis thaliana heat shoc...		Potri.014G131701 [exp]	0	1
AT4G32830		ATAUR1	ataurora1 (.1)		Potri.006G235000 [exp]	9.16	0.9413
AT3G19184	B3		AP2/B3-like transcriptional fa...		Potri.009G103200 [exp]	11.35	0.9403
AT1G13890		ATSNAP30, SNAP3...	soluble N-ethylmaleimide-sensi...		Potri.008G093800 [exp]	11.40	0.9409	SNAP30.2
AT3G19590		BUB3.1	BUB \(BUDDING UNINHIBITED BY B...		Potri.009G089200 [exp]	15.81	0.9304
AT4G08330			unknown protein		Potri.005G070600 [exp]	18.11	0.9325
AT5G04320			Shugoshin C terminus (.1.2)		Potri.004G216000 [exp]	18.43	0.9372
AT5G04320			Shugoshin C terminus (.1.2)		Potri.009G006100 [exp]	19.74	0.9370
AT3G20060		UBC19	ubiquitin-conjugating enzyme19...		Potri.001G254500 [exp]	22.58	0.9355	UBC19.2
AT1G80370		CYCA2;4	Cyclin A2;4 (.1)		Potri.001G177100 [exp]	24.18	0.9323
AT4G02800			unknown protein		Potri.002G053100 [exp]	25.78	0.9328

Compare expression of checked genes

Potri.014G131701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.