Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15800 123 / 1e-37 RALFL33 ralf-like 33 (.1) AT1G02900 122 / 3e-37 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT3G16570 104 / 6e-30 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT3G05490 93 / 1e-25 RALFL22 ralf-like 22 (.1) AT2G33775 84 / 4e-22 RALFL19 ralf-like 19 (.1) AT1G28270 83 / 9e-22 RALFL4 ralf-like 4 (.1) AT4G13950 72 / 3e-17 RALFL31 ralf-like 31 (.1) AT3G23805 64 / 2e-14 RALFL24 ralf-like 24 (.1) AT5G67070 55 / 1e-10 RALFL34 ralf-like 34 (.1) AT4G14010 42 / 5e-06 RALFL32 ralf-like 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G025800 [exp] 142 / 3e-45 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.013G017400 [exp] 126 / 1e-38 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.008G208200 [exp] 119 / 4e-36 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.004G044900 [exp] 82 / 2e-21 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 82 / 2e-21 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.017G059500 [exp] 76 / 2e-18 AT4G13950 96 / 2e-26 ralf-like 31 (.1) Potri.001G320700 [exp] 57 / 1e-11 AT3G23805 96 / 1e-26 ralf-like 24 (.1) Potri.007G044700 [exp] 55 / 1e-10 AT5G67070 119 / 1e-35 ralf-like 34 (.1) Potri.005G139100 [exp] 54 / 4e-10 AT5G67070 118 / 4e-35 ralf-like 34 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037512 [exp] 106 / 5e-31 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10000502 [exp] 105 / 1e-30 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10015172 [exp] 103 / 6e-30 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10020647 [exp] 102 / 5e-29 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10029893 [exp] 99 / 8e-28 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10015316 [exp] 78 / 1e-19 AT1G28270 100 / 7e-29 ralf-like 4 (.1) Lus10025444 [exp] 77 / 2e-19 AT1G28270 100 / 2e-28 ralf-like 4 (.1) Lus10005541 [exp] 61 / 3e-13 AT1G28270 69 / 3e-16 ralf-like 4 (.1) Lus10015431 [exp] 61 / 8e-13 AT1G28270 81 / 7e-21 ralf-like 4 (.1) Lus10016646 [exp] 58 / 7e-12 AT4G13950 100 / 1e-28 ralf-like 31 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [poplar] [flax] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Potri.014G131800.1 pacid=42763930 polypeptide=Potri.014G131800.1.p locus=Potri.014G131800 ID=Potri.014G131800.1.v4.1 annot-version=v4.1 ATGGCCAATTCCTACCGCTATCTCTTCCTCGTGTTGCTCCTTTCAGCTCTGATCATCTCTTCATCCACCGTCGATGCGAGTGAAGACCACAACCTCAACT GGGTCCCAACGAGAGCCAGAGGATGCCAAGGAACGGTGGCAGAATGCATGGGAAACGATGAGTTTGAGATGGACTCGGAGATAAACAGGCGCATATTGGC GACTAGCAACTACATAAGCTACGATGCTTTGGGGAAGAACAACGTACCATGTTCCCAGAGAGGTGCATCCTATTACAATTGCAAGACAGGTGCAGAGGCC AACCCTTATAGCCGTGGTTGCAGTGCTATTACTCGCTGCCGTAGTTGA
AA sequence Show only first row Show all	>Potri.014G131800.1 pacid=42763930 polypeptide=Potri.014G131800.1.p locus=Potri.014G131800 ID=Potri.014G131800.1.v4.1 annot-version=v4.1 MANSYRYLFLVLLLSALIISSSTVDASEDHNLNWVPTRARGCQGTVAECMGNDEFEMDSEINRRILATSNYISYDALGKNNVPCSQRGASYYNCKTGAEA NPYSRGCSAITRCRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G15800		RALFL33	ralf-like 33 (.1)		Potri.014G131800 [exp]	0	1
AT5G22890	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Potri.004G217100 [exp]	1.73	0.9776
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029700 [exp]	1.73	0.9820
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.014G028500 [exp]	2.00	0.9780
AT1G05577			Domain of unknown function (DU...		Potri.009G024900 [exp]	3.46	0.9760
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029200 [exp]	3.87	0.9756
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029600 [exp]	4.89	0.9741
AT1G52190			Major facilitator superfamily ...		Potri.018G041700 [exp]	5.19	0.9717
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029800 [exp]	5.29	0.9722
AT5G51160			Ankyrin repeat family protein ...		Potri.012G113800 [exp]	5.47	0.9699
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Potri.007G009400 [exp]	6.32	0.9718

Compare expression of checked genes

Potri.014G131800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.