Potri.014G133200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 436 / 2e-152 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 229 / 2e-71 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 179 / 1e-51 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 176 / 3e-50 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 166 / 1e-46 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 163 / 6e-46 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 163 / 6e-46 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61990 162 / 1e-45 Mitochondrial transcription termination factor family protein (.1)
AT5G23930 155 / 8e-43 Mitochondrial transcription termination factor family protein (.1)
AT1G62110 154 / 2e-42 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G046700 251 / 7e-80 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 244 / 3e-77 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 239 / 3e-75 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 235 / 1e-73 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 234 / 2e-73 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 233 / 3e-73 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046800 229 / 2e-71 AT5G07900 228 / 4e-71 Mitochondrial transcription termination factor family protein (.1)
Potri.008G216200 228 / 3e-71 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 228 / 7e-71 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040817 229 / 1e-71 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 229 / 2e-71 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 225 / 5e-70 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 219 / 1e-67 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10008688 214 / 1e-65 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10016553 177 / 4e-53 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 179 / 4e-52 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 144 / 4e-39 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10004329 141 / 6e-38 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10028912 140 / 8e-38 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.014G133200.1 pacid=42762798 polypeptide=Potri.014G133200.1.p locus=Potri.014G133200 ID=Potri.014G133200.1.v4.1 annot-version=v4.1
ATGGAGCTCATCCAAAATATCCGTTGTGTAAGATTGGACAATCCATCATCAATCTTCTCCTTTTCCCCTTCCAAAAGACACTTCTCCTTCTCACGAGAAT
TCAACAAAAACCCACATGTCTCTTTTCCAAATCAACCGCTTCCAAAACCAATCAGCTGCAAAATTTCAACAGAACAAGACTCTTTCACAATCAACTACCT
CGTACATTCATGTGGGTTGCCCTTGGAATCTGCAATCTTAACATCCCAAAAGGTACAGTTTCAATCCCCTGAAAGACCAGACTCCGTTTTGGCCCTTTTA
AGAAACCATGGATTCTCCAGAACCCAGATCTCAAGTCTTGTTAAAAAGCGCCCATTTCTTCTTTTATCCAATCCTACGAATACACTTTTGCCTAAACTTG
ACTTCTTTCTCTCTTTAGGTATGTCAAGGCCTCACCTTGCCAGAACTCTTTCTTCAGACCCAACCCTATTGACTAGAAGCTTGGAAAACCAAATTGTACC
CTCTTATAACTTTCTCAAAACCATCTTGCGTTCTGATGAAAAGATTGTTTCTGCTTTTAAGCGTACCACTTGGATATTTCTAGAGGATCTTTCAAAGAAT
CTTATACCAAATCTTGAGCTTTTGAGAAAAGTAGGCGTGCCACAGTCTTGCATTTCGTTATTGCTTACACATTTCCCTGAAGCTATGATGGAAAATCATG
ACGAGTTTAGTGAAAATGTAGAGGAAGTGAGAAAAATGGGATTTGATCCAAATAAATCAACTTTTGTGCTGGCTGTGCATGCCCTTTGTGGAAAGTGCAA
TAAGTCAATTTGGGAACGCTGTTTTGAGGTTTATGAGAGGTGGGGTTGGACTAAAGATGACATTCTTTCAGCATTTAGAAAGCATCCCCATTGTATGATG
CTATCGGAGAAGAAAATCATGAAAGGAATGGATTTTTTTGTGAACAAGATGGGGTGGCCTTCAAAGGAGATTGTGCATTGCCCTGTTATCTTGTTTTTAA
GCTTAGAGAAGAGAATTATCCCCAGGTGTAAGGTTATTCAGGTTTTGTGGTCAAAGGGTTTGATAAAGAAAGATATCAGCTTGAATACTGTGTTGCTTCC
TGTGGAGAAGCGCTTTCTGGAGAGGTTTGTGACCAAATTTGAAGAGGAAGTACCTCAATTATTGAGTGTCTATGAAGGGAAGGTGGATCCTGAGGGAGTA
TGA
AA sequence
>Potri.014G133200.1 pacid=42762798 polypeptide=Potri.014G133200.1.p locus=Potri.014G133200 ID=Potri.014G133200.1.v4.1 annot-version=v4.1
MELIQNIRCVRLDNPSSIFSFSPSKRHFSFSREFNKNPHVSFPNQPLPKPISCKISTEQDSFTINYLVHSCGLPLESAILTSQKVQFQSPERPDSVLALL
RNHGFSRTQISSLVKKRPFLLLSNPTNTLLPKLDFFLSLGMSRPHLARTLSSDPTLLTRSLENQIVPSYNFLKTILRSDEKIVSAFKRTTWIFLEDLSKN
LIPNLELLRKVGVPQSCISLLLTHFPEAMMENHDEFSENVEEVRKMGFDPNKSTFVLAVHALCGKCNKSIWERCFEVYERWGWTKDDILSAFRKHPHCMM
LSEKKIMKGMDFFVNKMGWPSKEIVHCPVILFLSLEKRIIPRCKVIQVLWSKGLIKKDISLNTVLLPVEKRFLERFVTKFEEEVPQLLSVYEGKVDPEGV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07900 Mitochondrial transcription te... Potri.014G133200 0 1
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Potri.017G030400 1.73 0.9771
AT5G48470 unknown protein Potri.002G251400 2.44 0.9735
AT4G29400 Protein of unknown function (D... Potri.014G148300 4.58 0.9708
AT3G03630 CS26 cysteine synthase 26 (.1) Potri.019G045800 4.89 0.9712
AT4G01037 AtWTF1 what's this factor?, Ubiquitin... Potri.014G096800 4.89 0.9691
AT4G25130 PMSR4 peptide met sulfoxide reductas... Potri.015G112268 5.00 0.9711
AT3G06730 TRXz, TRXP ,TRX... thioredoxin putative plastidic... Potri.001G028500 8.48 0.9635
AT3G16190 Isochorismatase family protein... Potri.003G051700 16.61 0.9083
AT3G18870 Mitochondrial transcription te... Potri.004G150600 17.88 0.9633
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Potri.017G030600 18.54 0.9428

Potri.014G133200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.