Potri.014G134100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G62940 338 / 5e-116 Cysteine proteinases superfamily protein (.1.2.3)
AT5G67170 69 / 7e-13 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 56 / 2e-08 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT5G04250 44 / 6e-05 Cysteine proteinases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G196800 63 / 8e-11 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.009G160100 59 / 2e-09 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.005G140500 55 / 3e-08 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005939 390 / 2e-136 AT3G62940 363 / 9e-126 Cysteine proteinases superfamily protein (.1.2.3)
Lus10040897 374 / 2e-130 AT3G62940 359 / 1e-124 Cysteine proteinases superfamily protein (.1.2.3)
Lus10005193 60 / 1e-09 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10006255 55 / 3e-08 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Lus10013303 52 / 4e-07 AT2G27350 468 / 7e-162 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.014G134100.1 pacid=42764433 polypeptide=Potri.014G134100.1.p locus=Potri.014G134100 ID=Potri.014G134100.1.v4.1 annot-version=v4.1
ATGTCGGATGCTCAAGAAATACAGGATCAACCAACTGAGGCAATTCCGGCCAATGTGTCTCAAAAGGAAGAGGAATCCCGTGATGAAATGCTTTCTCGGC
ACAGAAAGGAGATAAGACAGCTGCAGAACAAAGAAATTGAAATGAAAAAGGCAGCTGCAAAAGGTAGCAAGGCGGAACAGAAAGCTAAGAAAAAGTTGGT
CGAGGAAGAGGTCTCTCAACTATCTGCAAAGCTAAAAGAAAAACATGCTGAAGAACTTGCTTCTTTAGGTTACAACAGTACTAATGGAAATGAGAGTAGC
AATCTTGACAACTTGGTGAAGGCTGTAGCGGGGGTTTCTGTTACCAACCAGCCTGAGCATTCAAAGCCCAGCAAGAGCGCAAAGAGACGGGGGAAAAGAG
CTCAGCAAGAAGCAGAAAGAGAACAAAGAATACAAGAAGAGCAGAGCAACCTTGAAAGTGATCGAATGATTGAAGATGAAAAATTGGAAAGAAAGCTTGA
ACCCCTCGGGTTGACTATAAATGAAATAAAGCCAGATGGGCACTGCCTCTACCGAGCTGTTGAAGATCAGCTGGCACTCCTTTCTGGAGGTTCAGCACCA
TATGATTACCAAGAGCTTCGAAAATTGGTGGCTGCCTATATGAGGGAAAACTCACCAGATTTCCTCCCTTTTTTCCTGTCAGATACTATTACCGAAGAAC
ACTCTGATCATTCACTCTCAGATAGATTCGAGAATTACTGTAAAGAAGTTGAGTCTACAACAGCATGGGGAGGGCAGCTGGAGCTTGGGGCTCTAACTCA
CTGCCTCCGGAGGCATATCAAGATATTTTCAGGATCATTCCCTGATGTGGAGATGGGAAAGGAGTACAAATCTGACGGTGGTGCTGGTTCATCAAATGCA
AGCATTATGTTGTCGTACCATAAGCATGCGTTTGGTCTTGGGGAGCACTATAATTCTGTTGTTCCAAATTTGATCCAATAG
AA sequence
>Potri.014G134100.1 pacid=42764433 polypeptide=Potri.014G134100.1.p locus=Potri.014G134100 ID=Potri.014G134100.1.v4.1 annot-version=v4.1
MSDAQEIQDQPTEAIPANVSQKEEESRDEMLSRHRKEIRQLQNKEIEMKKAAAKGSKAEQKAKKKLVEEEVSQLSAKLKEKHAEELASLGYNSTNGNESS
NLDNLVKAVAGVSVTNQPEHSKPSKSAKRRGKRAQQEAEREQRIQEEQSNLESDRMIEDEKLERKLEPLGLTINEIKPDGHCLYRAVEDQLALLSGGSAP
YDYQELRKLVAAYMRENSPDFLPFFLSDTITEEHSDHSLSDRFENYCKEVESTTAWGGQLELGALTHCLRRHIKIFSGSFPDVEMGKEYKSDGGAGSSNA
SIMLSYHKHAFGLGEHYNSVVPNLIQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G62940 Cysteine proteinases superfami... Potri.014G134100 0 1
AT4G29510 ATPRMT1B, ATPRM... PROTEIN ARGININE METHYLTRANSFE... Potri.018G067200 4.00 0.7913 PRMT901
AT1G07840 Sas10/Utp3/C1D family (.1.2.3) Potri.005G152200 6.63 0.7745
AT3G25910 Protein of unknown function (D... Potri.006G154300 8.94 0.7524
AT2G40430 unknown protein Potri.008G075700 9.21 0.7070
AT5G22100 RNA cyclase family protein (.1... Potri.001G216400 9.79 0.7681
AT5G02820 BIN5, RHL2 ROOT HAIRLESS 2, BRASSINOSTERO... Potri.006G132600 24.73 0.7341 Pt-RHL2.1
AT1G53900 Eukaryotic translation initiat... Potri.001G163300 26.98 0.7167
AT2G19540 Transducin family protein / WD... Potri.007G094000 29.22 0.7103
AT2G47420 DIM1A adenosine dimethyl transferase... Potri.014G121200 30.85 0.7240
AT2G15790 CYP40, SQN SQUINT, CYCLOPHILIN 40, peptid... Potri.005G135500 32.78 0.6897

Potri.014G134100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.