Plant FIBer expression Database

Potri.014G135550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.014G135550.1 pacid=42762661 polypeptide=Potri.014G135550.1.p locus=Potri.014G135550 ID=Potri.014G135550.1.v4.1 annot-version=v4.1
ATGTCCAAAAAATATGAGGCCATGATGGGTCTTGATTCATATTCAAATGCTCTTGAACACTTTGTAACCTGTGGTTGTTCTATTGTAATGGGTTCGATTA
AAATCAGCTCAGTTATGTTAAATCTAAGTCTCTGTCCAGTCAACTACCACCATCGCTCCAAAACTGCTCTTTGTTATCTGTATTCTTGTCTTGTCATGCC
ACTGTTTTTCTCTTTCATTTTCCTTGTAGAAGTTAAAATAGCTTATGAAGAGGATAATTCAAGTAATGGAATACATTGCCAGTGCATTTACACCCCTAGG
GGGCATTATGAATTTTATAAAACTATCTATTTTTGA
AA sequence
>Potri.014G135550.1 pacid=42762661 polypeptide=Potri.014G135550.1.p locus=Potri.014G135550 ID=Potri.014G135550.1.v4.1 annot-version=v4.1
MSKKYEAMMGLDSYSNALEHFVTCGCSIVMGSIKISSVMLNLSLCPVNYHHRSKTALCYLYSCLVMPLFFSFIFLVEVKIAYEEDNSSNGIHCQCIYTPR
GHYEFYKTIYF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.014G135550
[exp]
0 1
AT3G05030 ATNHX2, NHX2 sodium hydrogen exchanger 2 (.... Potri.013G031700
[exp]
15.29 0.6399 Pt-NHX2.2
AT4G38040 Exostosin family protein (.1) Potri.007G117600
[exp]
17.32 0.6789
AT4G34280 transducin family protein / WD... Potri.009G092500
[exp]
28.26 0.6400
AT2G28840 XBAT31 XB3 ortholog 1 in Arabidopsis ... Potri.001G238800
[exp]
31.62 0.6593
AT4G38200 SEC7-like guanine nucleotide e... Potri.009G169800
[exp]
35.56 0.6719
AT3G07650 CO COL9 CONSTANS-like 9 (.1.2.3.4) Potri.002G214500
[exp]
37.22 0.6378
AT1G53730 SRF6 STRUBBELIG-receptor family 6 (... Potri.003G073700
[exp]
37.41 0.6153
AT2G32970 unknown protein Potri.014G158200
[exp]
41.80 0.6287
AT5G56460 Protein kinase superfamily pro... Potri.003G222600
[exp]
51.65 0.5853
AT4G00080 UNE11 unfertilized embryo sac 11, Pl... Potri.002G145800
[exp]
58.58 0.6098

Potri.014G135550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.