Plant FIBer expression Database

Potri.014G135560 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G213900
[exp]
116 / 3e-34 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.014G135560.1 pacid=42762983 polypeptide=Potri.014G135560.1.p locus=Potri.014G135560 ID=Potri.014G135560.1.v4.1 annot-version=v4.1
ATGGACAGAGTGAAGAACTCTGTTGATGTGTCTCCTTTCTTGCTAGTGGAAGCTGCGGGTGATTCTGAGGTTGATTCCGATCCCACCATGTCCACTATAG
ATCTTGTTGATGATGATGATGATGCAGAATCATGTAGCTGTGATACATCTGACCATTCTTGTGTCAGTGACATCATTAAAGGTGCTTGCAGCGAGGTTGA
AGCATACCAGGTCAATTACAATGTGGTCGATGATGATGATGATGACGAGGAGGAGGAGGAGGAGGGAGTTGAGGTTTGTCAATCATGGGTTCATCATGTC
CATGTTGGATTACCAGTGAAGCAAAAGTCATGTGTTTCAGTGGATTCAAGCAATGAATCGATGAACGAGAAGGAGAAGGATAGGTTGTTTTGGGAGGCTT
GCTTGGCTTCCTAA
AA sequence
>Potri.014G135560.1 pacid=42762983 polypeptide=Potri.014G135560.1.p locus=Potri.014G135560 ID=Potri.014G135560.1.v4.1 annot-version=v4.1
MDRVKNSVDVSPFLLVEAAGDSEVDSDPTMSTIDLVDDDDDAESCSCDTSDHSCVSDIIKGACSEVEAYQVNYNVVDDDDDDEEEEEEGVEVCQSWVHHV
HVGLPVKQKSCVSVDSSNESMNEKEKDRLFWEACLAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.014G135560
[exp]
0 1
AT2G26310 Chalcone-flavanone isomerase f... Potri.006G219600
[exp]
7.81 0.8742
AT2G27690 CYP94C1 "cytochrome P450, family 94, s... Potri.009G145400
[exp]
10.39 0.8672 CYP94C5,Pt-CYP94.4
AT1G73165 CLE1 CLAVATA3/ESR-RELATED 1 (.1) Potri.001G376100
[exp]
10.90 0.7124
AT1G03220 Eukaryotic aspartyl protease f... Potri.002G054900
[exp]
11.66 0.8655
AT1G11580 ATPMEPCRA methylesterase PCR A (.1) Potri.011G025400
[exp]
15.00 0.8541
AT1G61560 ATMLO6, MLO6 MILDEW RESISTANCE LOCUS O 6, S... Potri.011G058900
[exp]
17.94 0.8363
AT5G03980 SGNH hydrolase-type esterase s... Potri.005G024900
[exp]
19.36 0.8351
AT1G73325 Kunitz family trypsin and prot... Potri.019G124500
[exp]
21.35 0.8567
AT1G73325 Kunitz family trypsin and prot... Potri.019G122100
[exp]
21.44 0.8569
AT2G15780 Cupredoxin superfamily protein... Potri.009G106000
[exp]
25.29 0.8267

Potri.014G135560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.