Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G21770 111 / 2e-29 Peroxidase superfamily protein (.1) AT4G33420 107 / 1e-27 Peroxidase superfamily protein (.1) AT5G15180 107 / 2e-27 Peroxidase superfamily protein (.1) AT3G01190 103 / 4e-26 Peroxidase superfamily protein (.1) AT2G39040 99 / 1e-24 Peroxidase superfamily protein (.1) AT4G11290 96 / 2e-23 Peroxidase superfamily protein (.1) AT5G64110 96 / 3e-23 Peroxidase superfamily protein (.1) AT5G17820 93 / 1e-22 Peroxidase superfamily protein (.1) AT5G42180 93 / 2e-22 PER64 peroxidase 64, Peroxidase superfamily protein (.1) AT4G36430 91 / 2e-21 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G042800 [exp] 180 / 9e-56 AT1G05260 336 / 2e-115 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.007G122100 [exp] 112 / 1e-29 AT1G05260 496 / 3e-178 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.019G063201 [exp] 110 / 1e-28 AT3G01190 412 / 4e-145 Peroxidase superfamily protein (.1) Potri.007G122200 [exp] 108 / 6e-28 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1) Potri.017G038100 [exp] 107 / 1e-27 AT1G05260 479 / 7e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.007G122451 [exp] 104 / 1e-26 AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1) Potri.011G027300 [exp] 103 / 4e-26 AT3G01190 407 / 2e-143 Peroxidase superfamily protein (.1) Potri.004G023200 [exp] 100 / 2e-25 AT3G01190 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.004G023100 [exp] 100 / 3e-25 AT3G01190 403 / 1e-141 Peroxidase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021956 [exp] 124 / 2e-33 AT2G39040 323 / 6e-108 Peroxidase superfamily protein (.1) Lus10018374 [exp] 113 / 5e-30 AT3G01190 414 / 4e-146 Peroxidase superfamily protein (.1) Lus10041250 [exp] 114 / 6e-30 AT2G39040 310 / 3e-104 Peroxidase superfamily protein (.1) Lus10007638 [exp] 110 / 7e-29 AT3G01190 407 / 4e-143 Peroxidase superfamily protein (.1) Lus10029543 [exp] 104 / 1e-26 AT4G33420 479 / 1e-171 Peroxidase superfamily protein (.1) Lus10039681 [exp] 104 / 1e-26 AT4G11290 488 / 3e-175 Peroxidase superfamily protein (.1) Lus10031664 [exp] 104 / 1e-26 AT5G51890 453 / 1e-161 Peroxidase superfamily protein (.1) Lus10027405 [exp] 102 / 6e-26 AT5G51890 448 / 2e-159 Peroxidase superfamily protein (.1) Lus10006756 [exp] 100 / 5e-25 AT3G01190 379 / 3e-132 Peroxidase superfamily protein (.1) Lus10027163 [exp] 100 / 8e-25 AT4G11290 491 / 4e-176 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [poplar] [flax] Peroxidase PF00141 [poplar] [flax] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Potri.014G135580.1 pacid=42764806 polypeptide=Potri.014G135580.1.p locus=Potri.014G135580 ID=Potri.014G135580.1.v4.1 annot-version=v4.1 ATGGCTGCTTCGTCAGGGCAGGGTTGCGATGCCTCTGTTCTAGTAAACTCAACAGCAAATAACACCGCGGAGAAAGATGCAATTCCAAATCTGTCTTTGG TTATTGACGAGATAAAAACGCAGCTAGAGAACACATGTCCAGGAAAGGTATCTTGTGCTGATATTTTGGCCTTGTCTGCTAGGGACTCGGTTGCCTTCCA GTTCAAAAACCCAGAGTTGTGGGTAGAAGAGATGGCATTGTCTCAGAAGCTTTGGAGGCCTTCACAGACATTCCTTCCCCATTCTTCAATTTCTCGACGC CCCTTCAAAGTTTCAAGAGCAAAGGAACTTGACGTGCTGAATATCATGCTGCATGCGGGGGACACACCATTGGAGCAGGCCACTGCAACCTGCAACAACG ACGGTAGAGATAGACCCTGGCAGCTCTCAGAATTTCGATACTGCTTACTTCGCTATACTAAGCAGCGAAAGGGTCTCTTCCAATCCGATGCAGCCCTTCT AACAAACAGAACTCCGAACAAGATTGTTGGAGAGCTGCTTAACTCAAATGTTTTCTTCAGAGAATTTGCGCAACCAATGAAGAGAATGGGAGCAATCGGG GTTCTTCCTGGCACGTCAGGGGAGATCAGAAAGAAGTGTAGCGTTATCAATTCCTGA
AA sequence Show only first row Show all	>Potri.014G135580.1 pacid=42764806 polypeptide=Potri.014G135580.1.p locus=Potri.014G135580 ID=Potri.014G135580.1.v4.1 annot-version=v4.1 MAASSGQGCDASVLVNSTANNTAEKDAIPNLSLVIDEIKTQLENTCPGKVSCADILALSARDSVAFQFKNPELWVEEMALSQKLWRPSQTFLPHSSISRR PFKVSRAKELDVLNIMLHAGDTPLEQATATCNNDGRDRPWQLSEFRYCLLRYTKQRKGLFQSDAALLTNRTPNKIVGELLNSNVFFREFAQPMKRMGAIG VLPGTSGEIRKKCSVINS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G21770			Peroxidase superfamily protein...		Potri.014G135580 [exp]	0	1
AT1G80370		CYCA2;4	Cyclin A2;4 (.1)		Potri.003G058200 [exp]	4.00	0.9044
AT5G51545		LPA2	low psii accumulation2 (.1)		Potri.012G128000 [exp]	4.47	0.8664
AT3G15820		ROD1	REDUCED OLEATE DESATURATION 1,...		Potri.001G204100 [exp]	6.24	0.9028
AT1G14390			Leucine-rich repeat protein ki...		Potri.001G147700 [exp]	8.48	0.9033
AT3G06840			unknown protein		Potri.003G073200 [exp]	10.09	0.8690
AT3G51470			Protein phosphatase 2C family ...		Potri.005G102500 [exp]	10.09	0.8871
AT5G18820		Cpn60alpha2, EM...	embryo defective 3007, chapero...		Potri.015G123600 [exp]	11.48	0.8768
AT5G64570		ATBXL4, XYL4	ARABIDOPSIS THALIANA BETA-D-XY...		Potri.003G022900 [exp]	12.32	0.8932	XYL4.3
AT3G23670		PAKRP1L ,KINESI...	phragmoplast-associated kinesi...		Potri.014G149000 [exp]	18.70	0.8931	Pt-PAKRP1.1
AT3G55430			O-Glycosyl hydrolases family 1...		Potri.008G056000 [exp]	21.35	0.8810	Pt-GNS2.1

Compare expression of checked genes

Potri.014G135580 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.