Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26060 157 / 3e-48 EMB1345 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) AT4G32990 99 / 1e-25 Transducin/WD40 repeat-like superfamily protein (.1) AT5G13480 56 / 8e-10 FY Transducin/WD40 repeat-like superfamily protein (.1.2) AT3G49660 54 / 5e-09 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) AT5G67320 53 / 8e-09 HOS15 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1) AT5G52820 53 / 8e-09 WD-40 repeat family protein / notchless protein, putative (.1) AT3G44530 51 / 3e-08 HIRA homolog of histone chaperone HIRA (.1.2) AT2G43770 51 / 4e-08 Transducin/WD40 repeat-like superfamily protein (.1) AT2G41500 51 / 5e-08 EMB2776, LIS LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1) AT5G25150 49 / 1e-07 TAF5 TBP-associated factor 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G221000 [exp] 171 / 3e-53 AT2G26060 523 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.002G212800 [exp] 169 / 2e-52 AT2G26060 530 / 0.0 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.007G050100 [exp] 55 / 2e-09 AT5G67320 645 / 0.0 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1) Potri.004G184900 [exp] 54 / 3e-09 AT3G44530 1365 / 0.0 homolog of histone chaperone HIRA (.1.2) Potri.001G026800 [exp] 54 / 3e-09 AT5G13480 726 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.013G116900 [exp] 54 / 3e-09 AT1G71840 473 / 6e-167 transducin family protein / WD-40 repeat family protein (.1) Potri.009G144800 [exp] 54 / 5e-09 AT3G44530 1398 / 0.0 homolog of histone chaperone HIRA (.1.2) Potri.T125206 [exp] 53 / 1e-08 AT5G13480 759 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.006G263400 [exp] 52 / 1e-08 AT5G25150 1018 / 0.0 TBP-associated factor 5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017045 [exp] 169 / 8e-53 AT2G26060 486 / 5e-174 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10021365 [exp] 169 / 1e-52 AT2G26060 482 / 2e-172 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10020214 [exp] 56 / 1e-09 AT5G13480 738 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10026837 [exp] 56 / 1e-09 AT5G13480 759 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10029493 [exp] 54 / 3e-09 AT5G52820 786 / 0.0 WD-40 repeat family protein / notchless protein, putative (.1) Lus10039597 [exp] 54 / 3e-09 AT5G52820 792 / 0.0 WD-40 repeat family protein / notchless protein, putative (.1) Lus10020585 [exp] 54 / 7e-09 AT3G44530 1395 / 0.0 homolog of histone chaperone HIRA (.1.2) Lus10024972 [exp] 53 / 9e-09 AT5G67320 819 / 0.0 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1) Lus10004893 [exp] 53 / 1e-08 AT3G44530 1389 / 0.0 homolog of histone chaperone HIRA (.1.2) Lus10024447 [exp] 52 / 1e-08 AT5G25150 1006 / 0.0 TBP-associated factor 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00400 [poplar] [flax] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Potri.014G136700.3 pacid=42763712 polypeptide=Potri.014G136700.3.p locus=Potri.014G136700 ID=Potri.014G136700.3.v4.1 annot-version=v4.1 ATGATCAGGCAGTTCTGGAAGAAACACACTAGAACTGTTCGGTCGTGTGCCTGGTCTCCTTCTGGGAAATTGTTGGCAACGCCCAGCTTCGATGACACAA CTGCCACTTGGGAAATTAATGGCGGTGATTTCGAACGTGTAGCTGCTTTAGAGGGTCATGAAAATGAAGTGAAAAGCGTGCCTTGGAATGCATCTGGTTC GCTCCTTCAGACGTGTAGTAGGGATAAAACTGTTTGGATTTGGGAAGTAATGCCTGGGAATGAATCCGAGTGTGTTTCGGTTTTTCCAAGGACACTTAAA ATGGTTAAATGGCATCCAGCTATGGATGTTTTGTTTAGCTATGACAAGGTAAAATTGCTCATCTCTGCTCTTATTTCCACTGAAATAAGCTTCTTTAAAA ATTCCATTTCTGCTTTCGAATAA
AA sequence Show only first row Show all	>Potri.014G136700.3 pacid=42763712 polypeptide=Potri.014G136700.3.p locus=Potri.014G136700 ID=Potri.014G136700.3.v4.1 annot-version=v4.1 MIRQFWKKHTRTVRSCAWSPSGKLLATPSFDDTTATWEINGGDFERVAALEGHENEVKSVPWNASGSLLQTCSRDKTVWIWEVMPGNESECVSVFPRTLK MVKWHPAMDVLFSYDKVKLLISALISTEISFFKNSISAFE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G26060		EMB1345	embryo defective 1345, Transdu...		Potri.014G136700 [exp]	0	1
AT1G59820		ALA3	aminophospholipid ATPase 3 (.1...		Potri.008G191400 [exp]	12.96	0.8091	ALA3.2
AT1G14920	GRAS	RGA2, GAI	RESTORATION ON GROWTH ON AMMON...		Potri.017G149500 [exp]	17.14	0.8509
AT3G42170			BED zinc finger ;hAT family di...		Potri.011G125951 [exp]	18.00	0.8521
AT1G78060			Glycosyl hydrolase family prot...		Potri.005G168400 [exp]	19.77	0.8351
AT1G15780			unknown protein		Potri.003G028089 [exp]	20.19	0.8242
AT5G01720			RNI-like superfamily protein (...		Potri.006G105400 [exp]	21.16	0.8365
AT3G29310			calmodulin-binding protein-rel...		Potri.017G091100 [exp]	21.63	0.7867
AT4G20090		EMB1025	embryo defective 1025, Pentatr...		Potri.003G154800 [exp]	22.44	0.8396
AT2G32600			hydroxyproline-rich glycoprote...		Potri.016G097600 [exp]	25.29	0.8393
					Potri.001G298233 [exp]	26.32	0.8294

Compare expression of checked genes

Potri.014G136700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.