Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	GPX4.1,PtrcGpx4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G48150 271 / 1e-94 ATGPX4 glutathione peroxidase 4 (.1) AT3G63080 256 / 1e-88 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1) AT4G11600 231 / 1e-77 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1) AT2G31570 215 / 2e-72 ATGPX2 glutathione peroxidase 2 (.1) AT4G31870 215 / 2e-71 ATGPX7 glutathione peroxidase 7 (.1) AT2G25080 212 / 3e-70 ATGPX1 glutathione peroxidase 1 (.1) AT1G63460 203 / 1e-67 ATGPX8 glutathione peroxidase 8 (.1) AT2G43350 188 / 4e-61 ATGPX3 glutathione peroxidase 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G126100 [exp] 241 / 1e-81 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1) Potri.001G105200 [exp] 238 / 2e-81 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1) Potri.006G265400 [exp] 221 / 1e-73 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1) Potri.001G105100 [exp] 213 / 2e-71 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1) Potri.007G126600 [exp] 209 / 2e-69 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1) Potri.018G017500 [exp] 154 / 3e-48 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029651 [exp] 277 / 7e-97 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1) Lus10008537 [exp] 235 / 3e-80 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1) Lus10008499 [exp] 236 / 9e-80 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1) Lus10008022 [exp] 231 / 1e-78 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1) Lus10042418 [exp] 219 / 6e-73 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1) Lus10026887 [exp] 219 / 8e-73 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1) Lus10027021 [exp] 214 / 6e-72 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1) Lus10008023 [exp] 211 / 1e-69 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1) Lus10003421 [exp] 209 / 1e-67 AT4G31870 319 / 9e-110 glutathione peroxidase 7 (.1) Lus10000601 [exp] 200 / 2e-66 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00578 [poplar] [flax] AhpC-TSA AhpC/TSA family
Representative CDS sequence Show only first row Show all	>Potri.014G138800.2 pacid=42764769 polypeptide=Potri.014G138800.2.p locus=Potri.014G138800 ID=Potri.014G138800.2.v4.1 annot-version=v4.1 ATGGGGTCTTCTCCATCGGTACCAGAGAAATCAATCCATGAATTCACTGTCAAGGATAACAGAGGTCAGGACGTGAACCTTGGTATCTATAAAGGGAAGG TTCTTCTTGTGGTTAACGTCGCCTCTAAATGTGGATTTACAGATTCAAATTACACCCAGTTGACTGATCTTTATAAAAATTACAAGGACAAAGGTTTGGA AATCTTGGCGTTTCCATGTAACCAGTTTTTGAATCAAGAGCCTGGGACAAGCGAGGATGCTCAAAACTTTGCTTGTACTAGGTACAAGGCTGACTATCCA ATTTTCCACAAGGTTCGTGTTAATGGACCAAATGCTGCACCTGTATACAAGTTCCTCAAGGCAAGTAAACCTGGATTTCTGGGAAATAGGATAAAGTGGA ATTTTACCAAGTTCTTGGTTGACAAGGACGGGCATGTCCTTGGTCGCTATAGCACAATCACTGCTCCTATGGCCATTGAGGCTGATATCAAGAAAGCACT GGGAGAGATGTGA
AA sequence Show only first row Show all	>Potri.014G138800.2 pacid=42764769 polypeptide=Potri.014G138800.2.p locus=Potri.014G138800 ID=Potri.014G138800.2.v4.1 annot-version=v4.1 MGSSPSVPEKSIHEFTVKDNRGQDVNLGIYKGKVLLVVNVASKCGFTDSNYTQLTDLYKNYKDKGLEILAFPCNQFLNQEPGTSEDAQNFACTRYKADYP IFHKVRVNGPNAAPVYKFLKASKPGFLGNRIKWNFTKFLVDKDGHVLGRYSTITAPMAIEADIKKALGEM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G48150		ATGPX4	glutathione peroxidase 4 (.1)		Potri.014G138800 [exp]	0	1	GPX4.1,PtrcGpx4
AT2G39445			Phosphatidylinositol N-acetylg...		Potri.002G134800 [exp]	2.82	0.7668
AT1G54210		ATATG12, APG12,...	AUTOPHAGY 12 A, AUTOPHAGY 12, ...		Potri.001G169700 [exp]	4.89	0.7618
AT1G02305			Cysteine proteinases superfami...		Potri.002G184300 [exp]	5.29	0.7392
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Potri.014G153800 [exp]	5.29	0.7507
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Potri.003G110901 [exp]	6.08	0.7784
AT5G22950		VPS24.1	SNF7 family protein (.1)		Potri.004G215500 [exp]	6.24	0.7077
AT2G06025			Acyl-CoA N-acyltransferases (N...		Potri.006G142100 [exp]	12.72	0.6749
AT1G07080			Thioredoxin superfamily protei...		Potri.009G076200 [exp]	12.84	0.7216
AT4G19860			alpha/beta-Hydrolases superfam...		Potri.012G121596 [exp]	13.85	0.6787
AT3G58090			Disease resistance-responsive ...		Potri.006G216000 [exp]	14.83	0.7330

Compare expression of checked genes

Potri.014G138800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.