Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1) AT3G22260 269 / 1e-91 Cysteine proteinases superfamily protein (.1.2.3) AT5G04250 233 / 5e-76 Cysteine proteinases superfamily protein (.1.2) AT5G03330 220 / 6e-71 Cysteine proteinases superfamily protein (.1.2) AT2G39320 83 / 1e-19 Cysteine proteinases superfamily protein (.1) AT5G67170 66 / 2e-12 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2) AT2G27350 47 / 4e-06 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6) AT3G62940 42 / 0.0001 Cysteine proteinases superfamily protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G019700 [exp] 286 / 1e-98 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3) Potri.006G021700 [exp] 284 / 6e-98 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3) Potri.016G094700 [exp] 234 / 9e-77 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2) Potri.006G125900 [exp] 233 / 3e-76 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2) Potri.010G225400 [exp] 233 / 1e-75 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2) Potri.008G036700 [exp] 223 / 7e-72 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2) Potri.008G036900 [exp] 191 / 6e-62 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2) Potri.005G140500 [exp] 71 / 5e-14 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2) Potri.004G196800 [exp] 53 / 5e-08 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010459 [exp] 288 / 3e-99 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3) Lus10027312 [exp] 263 / 2e-88 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3) Lus10003816 [exp] 253 / 1e-85 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3) Lus10001404 [exp] 246 / 7e-81 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2) Lus10023019 [exp] 238 / 7e-78 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2) Lus10038708 [exp] 231 / 4e-75 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2) Lus10026525 [exp] 229 / 3e-74 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2) Lus10013813 [exp] 225 / 8e-73 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2) Lus10037977 [exp] 225 / 1e-72 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2) Lus10037388 [exp] 209 / 3e-67 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF02338 [poplar] [flax] OTU OTU-like cysteine protease
Representative CDS sequence Show only first row Show all	>Potri.014G140200.1 pacid=42764777 polypeptide=Potri.014G140200.1.p locus=Potri.014G140200 ID=Potri.014G140200.1.v4.1 annot-version=v4.1 ATGAGAAATGGGACATGGAGCGTGGGTGAATCTTCCAGCTCAACTTCCTTGAGCAGTCAGCATGATAATGAGGATGATCGGATGATTGCTCTTGTGTTAA CCGAGGAGTATGCCAACCTAGATGGAGGAGTCGCTAAACGCCTTTCAAACCTTGCACCTGTTCCTCATGTTCCGCGGATAAATTCCTACATTCCCAACCT GAGCGACGCCAGTTTGGATCATCAAAGGCTTCTTCAAAGGCTAAATGTTTATGGTTTATGTGAAGTGAAGGTTTCCGGGGATGGAAATTGTCAGTTCCGT GCACTTTCAGAGCAGATGTTCAAGTCACCTGAGCATCACAAGCATGTTCGAAAGGATGTTGTGAAACAGCTGAAAGAGCACCGCTCGTTATACGAAGGCC ATGTCCCGATGAAGTACAAACGTTATTGCAAGAAAATGGCAAAGTCTGGTGAATGGGGGGACCATGTTACCTTACAAGCAGCTGCTGATAAGTTTGCTGC TAAGATATGCCTTTTGACATCTTTTAGAGATACCTGTTTCATTGAAATTATGCCACAATACCAGCCACCAAAACGAGAGTTGTGGTTGAGTTTCTGGTCC GAGGTACACTACAACTCATTGTATGAAATCCGAGATGCTCCTGTTCCACAGAAGCCAAAGAAGAAACACTGGTTGTTCTAG
AA sequence Show only first row Show all	>Potri.014G140200.1 pacid=42764777 polypeptide=Potri.014G140200.1.p locus=Potri.014G140200 ID=Potri.014G140200.1.v4.1 annot-version=v4.1 MRNGTWSVGESSSSTSLSSQHDNEDDRMIALVLTEEYANLDGGVAKRLSNLAPVPHVPRINSYIPNLSDASLDHQRLLQRLNVYGLCEVKVSGDGNCQFR ALSEQMFKSPEHHKHVRKDVVKQLKEHRSLYEGHVPMKYKRYCKKMAKSGEWGDHVTLQAAADKFAAKICLLTSFRDTCFIEIMPQYQPPKRELWLSFWS EVHYNSLYEIRDAPVPQKPKKKHWLF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G02070			Cysteine proteinases superfami...		Potri.014G140200 [exp]	0	1
					Potri.019G059000 [exp]	1.00	0.8277
AT5G50230			Transducin/WD40 repeat-like su...		Potri.015G087200 [exp]	6.32	0.7747
AT5G20350		TIP1	TIP GROWTH DEFECTIVE 1, Ankyri...		Potri.018G121200 [exp]	6.70	0.7382
					Potri.010G079250 [exp]	15.23	0.7429
AT1G11270			F-box and associated interacti...		Potri.007G074084 [exp]	17.60	0.6861
AT5G42785			unknown protein		Potri.002G034300 [exp]	18.16	0.7488
AT4G36960			RNA-binding (RRM/RBD/RNP motif...		Potri.007G044400 [exp]	18.70	0.6797
AT5G47870		RAD52-2B, RAD52...	radiation sensitive 51-2, unkn...		Potri.003G158500 [exp]	19.05	0.7683
					Potri.004G122466 [exp]	21.44	0.7527
AT5G40250			RING/U-box superfamily protein...		Potri.017G072300 [exp]	23.43	0.6488

Compare expression of checked genes

Potri.014G140200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.