Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-EXT.15
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13870 527 / 0 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) AT2G06850 489 / 2e-176 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1) AT5G65730 310 / 3e-106 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1) AT3G23730 306 / 2e-104 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G37800 303 / 5e-103 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1) AT4G14130 300 / 3e-102 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT4G03210 299 / 1e-101 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) AT5G57550 298 / 2e-101 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT5G57560 291 / 2e-98 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT1G11545 289 / 2e-97 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G071000 [exp] 522 / 0 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.003G159700 [exp] 518 / 0 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Potri.007G008500 [exp] 315 / 6e-108 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1) Potri.005G201200 [exp] 311 / 1e-106 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.019G125000 [exp] 311 / 2e-106 AT4G03210 450 / 3e-161 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Potri.002G060500 [exp] 311 / 2e-106 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201250 [exp] 309 / 1e-105 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.013G152400 [exp] 307 / 7e-105 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Potri.014G146100 [exp] 304 / 8e-104 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003022 [exp] 503 / 0 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10011052 [exp] 501 / 0 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10040121 [exp] 496 / 4e-179 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10030923 [exp] 490 / 6e-177 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1) Lus10018503 [exp] 316 / 5e-108 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10039715 [exp] 316 / 5e-108 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10039643 [exp] 310 / 4e-106 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1) Lus10011597 [exp] 308 / 2e-105 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1) Lus10031586 [exp] 308 / 6e-105 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2) Lus10010938 [exp] 293 / 2e-99 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.014G140300.1 pacid=42763685 polypeptide=Potri.014G140300.1.p locus=Potri.014G140300 ID=Potri.014G140300.1.v4.1 annot-version=v4.1 ATGGCTTCTTTTCTGTGGAGTGTATGCTTAAGTTTCCTGCTTTTAGCTACCGTAACCAAGGGTGCTTCACCAAAACAGGTTTTGGATGTACCGTTCGGCC GCAACTATGCGCCTACTTGGGCTTTCGATCACATCAAATACATCAATGGAGGTTCTGAGATTCAGCTCAAACTGGACAAATTCACAGGGACTGGATTTCA ATCTAAAGGCTCTTACCTGTTTGGTCACTTTAGCATGCACATAAAGATGGTTCCAGGGGATTCTGCTGGAACTGTGACTGCATTCTATTTATCTTCTCAA ACCAATGAGCATGATGAGATAGACTTTGAGTTCTTGGGAAACAGAACAGGACAGCCCTACATCTTACAAACAAATGTGTATACTGGAGGGAAAGGAGACA AAGAGCAGAGAATTTATCTTTGGTTTGATCCTACCAAGGGATACCACGCCTACTCTGTACTTTGGAACATGTACCAGATCGTATTCTTTGTAGATGACGT GCCAATCAGAGTGTTCAAGAACAGCAAAGATTTAGGATTGAAGTTCCCATTCAACCAACCTATGAAGATATACTCAAGCCTTTGGAATGCAGATGACTGG GCGACGCGGGGTGGCTTGGAGAAGACTGACTGGGCCAAGGCTCCCTTCATAGCCTCCTACAAGGGCTTCCACATTGACGGTTGTGAGGCGTCGGTAAATG CCAAGTTCTGTGAGACACAAGGTAAGCGTTGGTGGGATCAGAAGGAGTTCCGAGATCTTGATGCCGCTCAATACAGGAAACTCGGGTGGGTTCGCAAAAA ATACACCATCTACAACTATTGCACGGATCGTGTTCGCTTTCCTTCTCTCCCTCCAGAATGCAAGCGTGACCATGACATTTAA
AA sequence Show only first row Show all	>Potri.014G140300.1 pacid=42763685 polypeptide=Potri.014G140300.1.p locus=Potri.014G140300 ID=Potri.014G140300.1.v4.1 annot-version=v4.1 MASFLWSVCLSFLLLATVTKGASPKQVLDVPFGRNYAPTWAFDHIKYINGGSEIQLKLDKFTGTGFQSKGSYLFGHFSMHIKMVPGDSAGTVTAFYLSSQ TNEHDEIDFEFLGNRTGQPYILQTNVYTGGKGDKEQRIYLWFDPTKGYHAYSVLWNMYQIVFFVDDVPIRVFKNSKDLGLKFPFNQPMKIYSSLWNADDW ATRGGLEKTDWAKAPFIASYKGFHIDGCEASVNAKFCETQGKRWWDQKEFRDLDAAQYRKLGWVRKKYTIYNYCTDRVRFPSLPPECKRDHDI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G13870		EXGT-A4, XTH5, ...	endoxyloglucan transferase A4,...		Potri.014G140300 [exp]	0	1	Pt-EXT.15
AT2G42570		TBL39	TRICHOME BIREFRINGENCE-LIKE 39...		Potri.019G090200 [exp]	1.73	0.8460
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Potri.015G099600 [exp]	21.09	0.7545
AT3G12720	MYB	ATMYB67, AtY53	myb domain protein 67 (.1)		Potri.001G075400 [exp]	21.35	0.7311
AT1G28340		AtRLP4	receptor like protein 4 (.1)		Potri.011G056800 [exp]	42.00	0.7515
AT2G12646			PLATZ transcription factor fam...		Potri.006G060500 [exp]	62.20	0.7317
AT3G07890			Ypt/Rab-GAP domain of gyp1p su...		Potri.002G218100 [exp]	66.87	0.7094
AT2G07050		CAS1	cycloartenol synthase 1 (.1)		Potri.006G079200 [exp]	72.02	0.7029
AT2G33205			Serinc-domain containing serin...		Potri.003G174200 [exp]	129.34	0.6824
AT1G73340			Cytochrome P450 superfamily pr...		Potri.017G154600 [exp]	131.59	0.6867
AT1G69080			Adenine nucleotide alpha hydro...		Potri.010G140200 [exp]	202.95	0.6797

Compare expression of checked genes

Potri.014G140300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.