Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54900 197 / 3e-65 ATGRXCP, CXIP1 GLUTAREDOXIN, CAX interacting protein 1 (.1) AT4G04950 121 / 1e-32 AtGRXS17 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) AT2G38270 114 / 5e-31 ATGRX2, CXIP2 GLUTAREDOXIN, CAX-interacting protein 2 (.1) AT3G15660 107 / 6e-30 ATGRX4 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2) AT5G20500 50 / 4e-08 Glutaredoxin family protein (.1) AT2G20270 40 / 0.0003 Thioredoxin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G042200 [exp] 125 / 4e-34 AT4G04950 750 / 0.0 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Potri.003G060600 [exp] 117 / 2e-33 AT3G15660 201 / 7e-67 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2) Potri.011G051400 [exp] 116 / 7e-31 AT4G04950 680 / 0.0 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Potri.016G119200 [exp] 108 / 3e-29 AT2G38270 393 / 2e-138 GLUTAREDOXIN, CAX-interacting protein 2 (.1) Potri.018G133400 [exp] 57 / 1e-10 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Potri.002G254100 [exp] 45 / 4e-06 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012592 [exp] 182 / 7e-59 AT3G54900 156 / 2e-48 GLUTAREDOXIN, CAX interacting protein 1 (.1) Lus10041501 [exp] 182 / 3e-58 AT3G54900 159 / 4e-49 GLUTAREDOXIN, CAX interacting protein 1 (.1) Lus10002847 [exp] 114 / 3e-31 AT2G38270 384 / 4e-135 GLUTAREDOXIN, CAX-interacting protein 2 (.1) Lus10018487 [exp] 107 / 2e-29 AT4G04950 280 / 5e-93 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Lus10011187 [exp] 103 / 5e-28 AT4G04950 322 / 8e-110 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Lus10008687 [exp] 100 / 5e-25 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2) Lus10011188 [exp] 66 / 2e-13 AT4G04950 297 / 1e-99 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Lus10021590 [exp] 50 / 4e-08 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1) Lus10017148 [exp] 49 / 2e-07 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10022844 [exp] 48 / 6e-07 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.014G141200.5 pacid=42762952 polypeptide=Potri.014G141200.5.p locus=Potri.014G141200 ID=Potri.014G141200.5.v4.1 annot-version=v4.1 ATGGGTTCCCAGTCATTGCTTGTGCTGTCAGCACCAACGACGATGATTCCGTCTAAAATTGCAGCATCATCCCTTGCGCCTCCTCGCCCTGGGCCCCTCT GCTTCCCTCGCGCTCTGACCATCACTGATTCTGTGGTTTTCAGAGTCAAGTCCAATTCTGCTCGGAATAAGCTTGCCTCCTCCATACGTTGTGCATTGAC TCCTGCGCTGAAGACTACATTGGATAAAGTTGTTACATCACACAAAGTTGTGCTTTTCATGAAGGGAACCAAGGACTTCCCTCAATGTGGATTTTCACAA ACTGTGGTGCAAATATTGAAGTCATTAAATGTACCTTTTGAATCAGTTAACATTCTAGAAAATGAATTGCTACGTCAAGGACTGAAGGATTATTCTAGCT GGCCTACGTTTCCTCAACTCTACATAGACGGAGAATTCTTTGGTGGCTGTGATATCACTGTTGAGGCATATAAGAGTGGCGAATTGCAGGAACAAGTGGA AAAGGCAATGTGCTCTTGA
AA sequence Show only first row Show all	>Potri.014G141200.5 pacid=42762952 polypeptide=Potri.014G141200.5.p locus=Potri.014G141200 ID=Potri.014G141200.5.v4.1 annot-version=v4.1 MGSQSLLVLSAPTTMIPSKIAASSLAPPRPGPLCFPRALTITDSVVFRVKSNSARNKLASSIRCALTPALKTTLDKVVTSHKVVLFMKGTKDFPQCGFSQ TVVQILKSLNVPFESVNILENELLRQGLKDYSSWPTFPQLYIDGEFFGGCDITVEAYKSGELQEQVEKAMCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G54900		ATGRXCP, CXIP1	GLUTAREDOXIN, CAX interacting ...		Potri.014G141200 [exp]	0	1
AT1G60000			RNA-binding (RRM/RBD/RNP motif...		Potri.008G172100 [exp]	3.00	0.9767	RNP1.2
AT3G05410			Photosystem II reaction center...		Potri.005G027100 [exp]	3.46	0.9711
AT1G28150			unknown protein		Potri.004G066900 [exp]	4.12	0.9632
AT4G39460		SAMC1, SAMT1	SAM TRANSPORTER1, S-adenosylme...		Potri.005G085900 [exp]	7.74	0.9643
AT4G19100		PAM68	photosynthesis affected mutant...		Potri.001G132001 [exp]	9.79	0.9717
AT4G18370		DEGP5, DEG5, HH...	PROTEASE HHOA PRECUSOR, DEGP p...		Potri.011G083300 [exp]	10.24	0.9717	Pt-HHOA.1
AT5G39210		CRR7	chlororespiratory reduction 7 ...		Potri.004G120300 [exp]	11.83	0.9706
AT4G02920			unknown protein		Potri.002G215800 [exp]	12.24	0.9609
AT3G12930			Lojap-related protein (.1)		Potri.011G142900 [exp]	12.40	0.9654
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Potri.018G028500 [exp]	14.49	0.9584

Compare expression of checked genes

Potri.014G141200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.